Corvus brachyrhynchos (American crow): 103614405 Help Entry 103614405         CDS       T08418                                  Symbol ARF4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism cbrc  Corvus brachyrhynchos (American crow) Pathway cbrc04144   Endocytosis Brite KEGG Orthology (KO) [BR:cbrc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103614405 (ARF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbrc04131]     103614405 (ARF4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbrc04147]     103614405 (ARF4)    04031 GTP-binding proteins [BR:cbrc04031]     103614405 (ARF4) Membrane trafficking [BR:cbrc04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     103614405 (ARF4) Exosome [BR:cbrc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103614405 (ARF4)   Exosomal proteins of other body fluids (saliva and urine)    103614405 (ARF4)   Exosomal proteins of colorectal cancer cells    103614405 (ARF4) GTP-binding proteins [BR:cbrc04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     103614405 (ARF4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU FLAD1_M RXYLT1_N Csa3_N CRISPR_Cas2 6PF2K AAA_18 Motif Other DBs NCBI-GeneID:  103614405 NCBI-ProteinID:  XP_008630557 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search TKSIFLFLLVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDK IRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMLQEDELRDAVLLLFANKQDLPNA MAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 504 nt NT seq  +upstreamnt  +downstreamnt actaaatcaatttttctcttccttctagttggtttggatgctgctggtaagacaaccatt ctttataaactgaaactaggagaaattgtcaccacaattcccactattggttttaatgtg gagacggtagaatataaaaacatttgtttcacagtttgggatgttggtggtcaagataaa attagacctctttggaggcattatttccaaaacacacagggcctcatttttgtggtagac agcaatgacagagagagaatccaggaagcagcagaagagctgcagaaaatgcttcaggag gatgagctgcgagatgcagtgctgcttctgtttgcaaacaaacaggatctgccaaatgcc atggcaatcagtgaaatgacagataaactaggtcttcagtccctgcgtaacagaacttgg tatgtccaggctacctgtgctacacaaggaactggtctgtatgagggacttgactggctg tcaaatgaactctcaaaacgctaa

DBGET integrated database retrieval system