Corvus brachyrhynchos (American crow): 103615028 Help Entry 103615028         CDS       T08418                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism cbrc  Corvus brachyrhynchos (American crow) Pathway cbrc04814   Motor proteins cbrc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cbrc00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     103615028 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103615028 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cbrc03037]     103615028 (DYNLT3)    04812 Cytoskeleton proteins [BR:cbrc04812]     103615028 (DYNLT3) Cilium and associated proteins [BR:cbrc03037]  Motile cilia and associated proteins   Dynein arm    103615028 (DYNLT3) Cytoskeleton proteins [BR:cbrc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      103615028 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  103615028 NCBI-ProteinID:  XP_008631254 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MIFNADEAHNIVKECIESVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGKTYKYIVTCAV MQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIVL NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgatcttcaatgctgacgaggcccacaacatagttaaagagtgcatagaaagtgtttta ggcaaggcagattataatcacaacaaagtcaaccaatggactgctgctatagtagaacag tcgctgacacatctggtgaaacttgggaaaacctataagtacattgttacctgtgcagtg atgcagaggagtggagctggtctccacacagcaagttcatgcttctgggataccacaact gatggaacctgcacagtgagatgggaaaacagaaccatgaactgcattgtcaatgtattt gctgttgctattgtcctgtag

DBGET integrated database retrieval system