Corvus brachyrhynchos (American crow): 103615719 Help Entry 103615719         CDS       T08418                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism cbrc  Corvus brachyrhynchos (American crow) Pathway cbrc04060   Cytokine-cytokine receptor interaction cbrc04620   Toll-like receptor signaling pathway cbrc04622   RIG-I-like receptor signaling pathway cbrc04625   C-type lectin receptor signaling pathway cbrc05164   Influenza A cbrc05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:cbrc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103615719 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103615719 (IL12A)    04622 RIG-I-like receptor signaling pathway     103615719 (IL12A)    04625 C-type lectin receptor signaling pathway     103615719 (IL12A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     103615719 (IL12A)    05168 Herpes simplex virus 1 infection     103615719 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cbrc04052]     103615719 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:cbrc00536]     103615719 (IL12A) Cytokines and neuropeptides [BR:cbrc04052]  Cytokines   Interleukins    103615719 (IL12A) Glycosaminoglycan binding proteins [BR:cbrc00536]  Heparan sulfate / Heparin   Cytokines    103615719 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  103615719 NCBI-ProteinID:  XP_017589846 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MNTIKACTAEDPGPGNCPALERSTFDKGKCLQGISEDLRAYRAQLRNLNDPQLLVTLDGM MEALGSSTGKVPEALAGLGLGSGLGSAPFPDRLRLCSVLQAFRIRSVTISRMLSFLSSL NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaacacaatcaaagcctgcacagctgaggatccagggcctggaaactgcccagccctg gaaagatcaacttttgataagggcaaatgcctgcagggcatctctgaggacctcagagcc tacagggcacagctgaggaacctcaacgacccccagctcctggtgactctcgatgggatg atggaggccctgggcagcagcactgggaaggttccggaggcgctggcaggattgggattg ggatcgggattgggatcggccccgttcccggacaggctgaggctctgcagtgtcctccag gctttccgcatccgcagcgtcaccatcagcaggatgctgagcttcctgagctccctctga

DBGET integrated database retrieval system