Corvus brachyrhynchos (American crow): 103616211 Help Entry 103616211         CDS       T08418                                  Symbol CLDN19 Name (RefSeq) claudin-19   KO K06087   claudin Organism cbrc  Corvus brachyrhynchos (American crow) Pathway cbrc03272   Virion - Hepatitis viruses cbrc04382   Cornified envelope formation cbrc04514   Cell adhesion molecule (CAM) interaction cbrc04530   Tight junction Brite KEGG Orthology (KO) [BR:cbrc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     103616211 (CLDN19)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     103616211 (CLDN19)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     103616211 (CLDN19)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     103616211 (CLDN19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cbrc03037]     103616211 (CLDN19)    04147 Exosome [BR:cbrc04147]     103616211 (CLDN19) Cilium and associated proteins [BR:cbrc03037]  Other cilia and associated proteins   Stereociliary proteins    103616211 (CLDN19) Exosome [BR:cbrc04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    103616211 (CLDN19)   Exosomal proteins of colorectal cancer cells    103616211 (CLDN19) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF1218 CD20 Motif Other DBs NCBI-GeneID:  103616211 NCBI-ProteinID:  XP_017590607 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MVISLLLGFFGIIVSVVGMKCTKVGEEDPVTKSRIAVAGGVLFILSGLCTLAAVSLYATQ VTYEFFRESTIPINARYEFGSALFVGWGAASLSMLGGSLLCCSCPAKEPRGQQYHRQSQP STAREYV NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggtcatttctctcctcctgggcttctttggtatcatcgtgagcgtggtgggcatgaag tgcactaaagttggggaggaggatcctgtcaccaagagccgcatagctgttgctggaggt gtcctcttcattctgtctggtctgtgcacactggctgctgtgtcgttgtatgcaacacag gtgacctatgagttcttcagagagagtaccatccccatcaacgctaggtacgaattcggc tctgctctcttcgtgggctggggggctgccagcctctccatgctgggtgggtccctcctg tgctgctcctgccctgccaaggagccccgaggacagcagtaccatcggcagtcacagccc tccacggcccgggaatatgtctga

DBGET integrated database retrieval system