Corvus brachyrhynchos (American crow): 103618192 Help Entry 103618192         CDS       T08418                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism cbrc  Corvus brachyrhynchos (American crow) Pathway cbrc03082   ATP-dependent chromatin remodeling cbrc04217   Necroptosis Brite KEGG Orthology (KO) [BR:cbrc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103618192  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103618192  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cbrc03036]     103618192   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbrc04147]     103618192 Chromosome and associated proteins [BR:cbrc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103618192 Exosome [BR:cbrc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103618192 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  103618192 NCBI-ProteinID:  XP_008634798 UniProt:  A0A091ETZ6 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search NDAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLL GKVTIAQGGVLPNIQAVLLPKKTESHKAKSK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt aacgacgcggagcgcgtgggcgccggcgccccggtgtacctggcggccgtgctggagtac ctgacggccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgc atcatcccccgccacctgcagctcgccatccgcaacgacgaggagctcaacaagctgctg ggcaaggtgacgatcgcgcagggcggcgtgctgcccaacatccaggccgtgctgctgccc aagaagactgagagccacaaggctaaaagcaaataa

DBGET integrated database retrieval system