Corvus brachyrhynchos (American crow): 103619366 Help Entry 103619366         CDS       T08418                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism cbrc  Corvus brachyrhynchos (American crow) Pathway cbrc04814   Motor proteins cbrc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cbrc00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     103619366 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103619366 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cbrc03037]     103619366 (DYNLT1)    04812 Cytoskeleton proteins [BR:cbrc04812]     103619366 (DYNLT1) Cilium and associated proteins [BR:cbrc03037]  Motile cilia and associated proteins   Dynein arm    103619366 (DYNLT1) Cytoskeleton proteins [BR:cbrc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      103619366 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  103619366 NCBI-ProteinID:  XP_008636124 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDEFQTGEETAFVVDEVSSIIKEAIEGAIGGNAYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAL NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgagttccagacgggagaggagactgcctttgttgttgatgaagtcagtagcatt attaaagaggccatagagggtgctatcggtggcaatgcctaccagcacagcaaagtgaac cagtggacaacaagcgtggtggaacaaaccctgagccagctcacaaagctggggaagccc ttcaagtacatcgtgacttgtgtgattatgcaaaagaatggtgctgggctacatacagca agctcttgcttctgggacaactccagtgatggaacctgcactgtgagatgggagaataag accatgtactgtattgtcagtgcctttggacttgcattataa

DBGET integrated database retrieval system