Corvus brachyrhynchos (American crow): 103619856 Help Entry 103619856         CDS       T08418                                  Symbol CALML4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism cbrc  Corvus brachyrhynchos (American crow) Pathway cbrc04020   Calcium signaling pathway cbrc04070   Phosphatidylinositol signaling system cbrc04114   Oocyte meiosis cbrc04218   Cellular senescence cbrc04261   Adrenergic signaling in cardiomyocytes cbrc04270   Vascular smooth muscle contraction cbrc04371   Apelin signaling pathway cbrc04625   C-type lectin receptor signaling pathway cbrc04744   Phototransduction cbrc04910   Insulin signaling pathway cbrc04912   GnRH signaling pathway cbrc04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cbrc00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     103619856 (CALML4)    04020 Calcium signaling pathway     103619856 (CALML4)    04070 Phosphatidylinositol signaling system     103619856 (CALML4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103619856 (CALML4)    04218 Cellular senescence     103619856 (CALML4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103619856 (CALML4)   09152 Endocrine system    04910 Insulin signaling pathway     103619856 (CALML4)    04912 GnRH signaling pathway     103619856 (CALML4)    04916 Melanogenesis     103619856 (CALML4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103619856 (CALML4)    04270 Vascular smooth muscle contraction     103619856 (CALML4)   09157 Sensory system    04744 Phototransduction     103619856 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cbrc01009]     103619856 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbrc04131]     103619856 (CALML4)    03036 Chromosome and associated proteins [BR:cbrc03036]     103619856 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbrc04147]     103619856 (CALML4) Protein phosphatases and associated proteins [BR:cbrc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103619856 (CALML4) Membrane trafficking [BR:cbrc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103619856 (CALML4) Chromosome and associated proteins [BR:cbrc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103619856 (CALML4) Exosome [BR:cbrc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103619856 (CALML4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_9 EF-hand_1 AIF-1 EF-hand_8 EF-hand_5 EF_EFCAB10_C LisH_WDR26 GPHH Motif Other DBs NCBI-GeneID:  103619856 NCBI-ProteinID:  XP_017594037 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MAKFLSQDQINEFKECFSLYDKKQKGKIKASELLAVMRCLGASPTPGEVQRHLHLHRIDR NAELDFSTFLNIMYRQMKQEEPEKEILTALAMIDRQKRGVITVPELRAKLTQLGEKLSEE EVDDLLKEAKVGPNGTIRYEEFVRLICLPLADY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcaaagtttctgtcccaggatcaaattaatgagttcaaggaatgtttttccctgtac gacaagaagcagaaaggcaagatcaaagcctcggagctgctggccgtgatgaggtgcctg ggagccagccccacgccaggggaggtgcagagacacctgcacctgcacaggatcgacagg aacgcagagctggacttctccaccttcctgaacatcatgtacaggcagatgaagcaggag gagcccgagaaggagatcctgacggccctggccatgatcgaccggcagaagagaggggtc atcaccgtgcccgagctccgggccaagctcacccagctgggtgagaagctttccgaggaa gaagtcgatgacctgctgaaagaggccaaagttgggccaaacggaaccatccgatacgaa gaatttgtgcgcctcatttgcctccctttggccgactactga

DBGET integrated database retrieval system