Corvus brachyrhynchos (American crow): 103620698 Help Entry 103620698         CDS       T08418                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism cbrc  Corvus brachyrhynchos (American crow) Pathway cbrc04010   MAPK signaling pathway cbrc04012   ErbB signaling pathway cbrc04068   FoxO signaling pathway cbrc04137   Mitophagy - animal cbrc04140   Autophagy - animal cbrc04144   Endocytosis cbrc04150   mTOR signaling pathway cbrc04210   Apoptosis cbrc04218   Cellular senescence cbrc04370   VEGF signaling pathway cbrc04371   Apelin signaling pathway cbrc04510   Focal adhesion cbrc04540   Gap junction cbrc04625   C-type lectin receptor signaling pathway cbrc04810   Regulation of actin cytoskeleton cbrc04910   Insulin signaling pathway cbrc04912   GnRH signaling pathway cbrc04916   Melanogenesis cbrc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cbrc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103620698 (HRAS)    04012 ErbB signaling pathway     103620698 (HRAS)    04370 VEGF signaling pathway     103620698 (HRAS)    04371 Apelin signaling pathway     103620698 (HRAS)    04068 FoxO signaling pathway     103620698 (HRAS)    04150 mTOR signaling pathway     103620698 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103620698 (HRAS)    04140 Autophagy - animal     103620698 (HRAS)    04137 Mitophagy - animal     103620698 (HRAS)   09143 Cell growth and death    04210 Apoptosis     103620698 (HRAS)    04218 Cellular senescence     103620698 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103620698 (HRAS)    04540 Gap junction     103620698 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103620698 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103620698 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103620698 (HRAS)    04912 GnRH signaling pathway     103620698 (HRAS)    04916 Melanogenesis     103620698 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103620698 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbrc04131]     103620698 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbrc04147]     103620698 (HRAS)    04031 GTP-binding proteins [BR:cbrc04031]     103620698 (HRAS) Membrane trafficking [BR:cbrc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103620698 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103620698 (HRAS) Exosome [BR:cbrc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103620698 (HRAS)   Exosomal proteins of colorectal cancer cells    103620698 (HRAS) GTP-binding proteins [BR:cbrc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103620698 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  103620698 NCBI-ProteinID:  XP_008637585 UniProt:  A0A091F2K6 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatacaagctggtggtggtgggagcaggtggtgttgggaagagtgctttgacg atacagctcattcagaaccattttgttgatgagtatgaccccacgatagaggattcctac agaaagcaagtagtcattgatggagaaacctgtttgttagacatcttggacactgcaggg caggaggagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctgtgt gtctttgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagacgatgttcccatggtgctggtggggaataaatgtgacctc cctgcccggacagtggagacccggcaagcgcaggacctggcccggagctatgggatcccc tacatagaaacatctgccaaaaccagacagggcgttgaggatgccttctacaccttggtg cgggagatccggcagcataagctgcgcaagctgaatcccccggatgagagcggccccggc tgcatgaactgtaaatgtgtggtatcgtga

DBGET integrated database retrieval system