Corvus brachyrhynchos (American crow): 103622279 Help Entry 103622279         CDS       T08418                                  Symbol APITD1 Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism cbrc  Corvus brachyrhynchos (American crow) Pathway cbrc03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:cbrc00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     103622279 (APITD1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cbrc03036]     103622279 (APITD1)    03400 DNA repair and recombination proteins [BR:cbrc03400]     103622279 (APITD1) Chromosome and associated proteins [BR:cbrc03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      103622279 (APITD1) DNA repair and recombination proteins [BR:cbrc03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      103622279 (APITD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone DASH_Dad2 Motif Other DBs NCBI-GeneID:  103622279 NCBI-ProteinID:  XP_017599450 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search GPVCHCLPLLWSLQRLKAAVHYTVGCLCQEVEEDKDVQFSKQSIAAIAEITFGQCEIFAK DLEMFARHAKRTTVNTEDVKLLARRSNSLLKYITQKSEELASSNMEQKEKKKKKSSAAKG GRTPGEQEAAVTENEDSSMA NT seq 423 nt NT seq  +upstreamnt  +downstreamnt gggccggtgtgtcactgcctgcccctgctttggtccctgcagaggctgaaggcggcggtt cactacacggtggggtgcctgtgccaggaggtggaggaggacaaggacgtgcagttcagc aaacagagcatagcggccatcgcagagatcaccttcgggcagtgcgaaatctttgcaaaa gacctggaaatgtttgcaaggcatgcaaaacgaaccacagtcaacacagaagatgtgaag cttttggctagaagaagcaattctctgctaaaatatatcactcagaagagtgaagagctt gcatcaagtaacatggagcagaaggagaagaagaaaaagaagtccagtgcagctaaggga gggagaactcctggggaacaagaagcagctgtgactgaaaatgaagattccagcatggca tga

DBGET integrated database retrieval system