Corvus brachyrhynchos (American crow): 103625276 Help Entry 103625276         CDS       T08418                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism cbrc  Corvus brachyrhynchos (American crow) Pathway cbrc04010   MAPK signaling pathway cbrc04012   ErbB signaling pathway cbrc04068   FoxO signaling pathway cbrc04137   Mitophagy - animal cbrc04140   Autophagy - animal cbrc04150   mTOR signaling pathway cbrc04210   Apoptosis cbrc04218   Cellular senescence cbrc04370   VEGF signaling pathway cbrc04371   Apelin signaling pathway cbrc04540   Gap junction cbrc04625   C-type lectin receptor signaling pathway cbrc04810   Regulation of actin cytoskeleton cbrc04910   Insulin signaling pathway cbrc04912   GnRH signaling pathway cbrc04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cbrc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103625276 (NRAS)    04012 ErbB signaling pathway     103625276 (NRAS)    04370 VEGF signaling pathway     103625276 (NRAS)    04371 Apelin signaling pathway     103625276 (NRAS)    04068 FoxO signaling pathway     103625276 (NRAS)    04150 mTOR signaling pathway     103625276 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103625276 (NRAS)    04137 Mitophagy - animal     103625276 (NRAS)   09143 Cell growth and death    04210 Apoptosis     103625276 (NRAS)    04218 Cellular senescence     103625276 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     103625276 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103625276 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103625276 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103625276 (NRAS)    04912 GnRH signaling pathway     103625276 (NRAS)    04916 Melanogenesis     103625276 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbrc04131]     103625276 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbrc04147]     103625276 (NRAS)    04031 GTP-binding proteins [BR:cbrc04031]     103625276 (NRAS) Membrane trafficking [BR:cbrc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103625276 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103625276 (NRAS) Exosome [BR:cbrc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103625276 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    103625276 (NRAS)   Exosomal proteins of breast cancer cells    103625276 (NRAS)   Exosomal proteins of colorectal cancer cells    103625276 (NRAS) GTP-binding proteins [BR:cbrc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103625276 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc RsgA_GTPase FeoB_N GTP_EFTU Arf IL23 TPP_enzyme_M Motif Other DBs NCBI-GeneID:  103625276 NCBI-ProteinID:  XP_008642905 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVD TKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQGCMGLSC LVM NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgagggaccagtacatgaggacaggggaaggcttcctctgcgtgtttgccatcaacaac agcaaatccttcgccgacatcaacctctacagagaacagatcaagagagtgaaggactcg gatgacgtgcccatggtgctggtggggaacaaatgtgatctgcccacgagaacagtggac acaaaacaggcccaagaattggcaaaaagctacggaatccccttcatagagacctctgca aaaacgagacagggtgtggaagatgctttttacactctggtgagagagatccggcagtac cggatgaagaagctcaacagcagcgaggatgggaaccagggctgcatgggactgtcctgc cttgtcatgtga

DBGET integrated database retrieval system