Culicoides brevitarsis: 134835878 Help Entry 134835878         CDS       T10947                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cbri  Culicoides brevitarsis Pathway cbri04013   MAPK signaling pathway - fly cbri04145   Phagosome cbri04148   Efferocytosis cbri04310   Wnt signaling pathway cbri04620   Toll-like receptor signaling pathway cbri05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cbri00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     134835878    04310 Wnt signaling pathway     134835878  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     134835878    04148 Efferocytosis     134835878  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     134835878  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     134835878  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cbri04131]     134835878   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cbri04147]     134835878    04031 GTP-binding proteins [BR:cbri04031]     134835878 Membrane trafficking [BR:cbri04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     134835878  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     134835878   Macropinocytosis    Ras GTPases     134835878  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     134835878 Exosome [BR:cbri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134835878   Exosomal proteins of other body fluids (saliva and urine)    134835878   Exosomal proteins of colorectal cancer cells    134835878   Exosomal proteins of bladder cancer cells    134835878 GTP-binding proteins [BR:cbri04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     134835878 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  134835878 NCBI-ProteinID:  XP_063706938 LinkDB All DBs Position 3:complement(25797210..25801490) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR DDKSTIEKLRDKKLSPITYPQGLAMNKEIGGVKYLECSALTQKGLKTVFDEAIRAVLCPV APPKPKRKCVIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaagtgtgtggtagttggcgatggtgccgttggtaagacatgcttgctt atcagttacactacaaatgccttccccggagagtatattcccacagtattcgacaattac tctgccaacgtgatggtcgatggcaaaccaatcaacttaggtttatgggatacagctggg caggaagattacgatcgtctccgtccattgtcgtacccacaaacggatgtttttctcatt tgtttctctctcgtcaatccggcttcctttgagaacgtcagagccaagtggtatcctgaa gtcagacatcattgtcccgcaactccaattattctcgttggcacaaaattagatttacgc gacgataaatcaaccattgaaaaattgcgtgataaaaaattatcgccaattacatatcct cagggtttagcaatgaataaggaaattggtggcgtaaaatatcttgaatgttctgcactc acacaaaaaggcttgaaaacagtctttgacgaagcgatacgagcagtactctgtcccgtt gcaccacccaagcccaaacgaaaatgtgtcattttataa

DBGET integrated database retrieval system