Coxiella burnetii RSA 493: CBU_0496 Help Entry CBU_0496          CDS       T00124                                  Symbol acpP Name (RefSeq) acyl carrier protein   KO K02078   acyl carrier protein Organism cbu  Coxiella burnetii RSA 493 Pathway cbu01100   Metabolic pathways cbu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cbu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CBU_0496 (acpP)    00074 Mycolic acid biosynthesis     CBU_0496 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CBU_0496 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 DUF3924 DUF1493 Motif Other DBs NCBI-GeneID:  1208380 NCBI-ProteinID:  NP_819530 UniProt:  Q83E38 LinkDB All DBs Position 437008..437262 Genome browser AA seq 84 aa AA seqDB search MATVEERVKKIVVEQLGVKEEEVTNSASFVDDLGADSLDTVELVMAFEEEFETEIPDEDA EKITTVQQAIDYIKEHSASESTSA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcaacagttgaagaacgagtcaaaaagattgtcgttgaacaattaggcgtaaaggaa gaagaagttaccaacagtgcttcgtttgtagacgatttaggtgctgattccctagatacg gtggagttggtgatggcatttgaagaggaattcgaaactgaaatccccgatgaagatgct gaaaaaattaccactgtccaacaagcgattgactatatcaaagaacattccgcgagcgaa tccacttctgcgtga

DBGET integrated database retrieval system