Cupriavidus basilensis: RR42_m2150 Help Entry RR42_m2150        CDS       T03642                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism cbw  Cupriavidus basilensis Pathway cbw00998   Biosynthesis of various antibiotics cbw01100   Metabolic pathways cbw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cbw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RR42_m2150    00074 Mycolic acid biosynthesis     RR42_m2150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RR42_m2150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AJG19542 UniProt:  A0A0C4Y2X8 LinkDB All DBs Position main:2279947..2280195 Genome browser AA seq 82 aa AA seqDB search MKDADIRAVALATLRSIAPEVEAEKLRPDRPLRKQVDLDSMDWLNFLIDLHEKLGVEIPE SDYARLVTLDDVVAYIANATGN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaaggatgccgatatccgcgccgtcgccctggccaccctccgctcgatcgcgcccgag gtagaagcggagaaacttcgcccggatcgtccgctgcggaaacaggtggaccttgactcg atggactggctcaatttcctgattgacttgcacgagaagctgggcgtggaaattccagag tccgactatgccaggctggttacccttgacgatgttgtcgcttatattgcgaacgcaacg gggaattag

DBGET integrated database retrieval system