Cupriavidus basilensis: RR42_m3302
Help
Entry
RR42_m3302 CDS
T03642
Name
(GenBank) Transcriptional regulator
Organism
cbw
Cupriavidus basilensis
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LysR_substrate
HTH_1
PBP_like_2
DUF6374
Motif
Other DBs
NCBI-ProteinID:
AJG20670
UniProt:
A0A0C4YD35
LinkDB
All DBs
Position
main:complement(3507904..3508926)
Genome browser
AA seq
340 aa
AA seq
DB search
MDLRQLRYFVTVAEELHFGRAARRLAMTQPPLSQQIQALEEEIGVQLFARTRRSVALTPA
GQQWLPEVRRVLADAAALPGLAQRLARGEAGTLSLAFVSTADYGILPDLLRRFRARHPNV
QLQLREATSDIQLEALMDGGIDAGLVIRPQLPAMPHGVAYLPLVREPLVLAVPQGWRPDG
SAGAADGTEPGVSLKEAAHEPLIIFPRRSAPAFYDIITGCYAREGLTPVIAQEAIQMQTI
VSLVSAGMGVALVPASLCNLRRTGVSYLPLRGAGPDIETGLVWREAGADSVSPVLRSFIE
IAGALAAAMTLTQNAGITPGTEPGAQLGTAAAATHLTDAA
NT seq
1023 nt
NT seq
+upstream
nt +downstream
nt
ttggacctgcgccagttgcgctatttcgtcaccgtggcggaggagttacatttcggccgc
gccgcgcggcgcctggccatgacgcagccgccgctgtcccagcagatccaggcgctggag
gaggagatcggcgtgcagctgttcgcccgcacgcggcgctcagtggcgctcacccctgcc
ggccagcaatggctgcccgaggtgcgccgcgtgctggccgatgcggccgcgctgccgggc
ctggcccagcggctggcgcgcggggaggccggcacgctgtcgctggcctttgtcagcacg
gccgactatggcatcctgcccgacctgctgcggcgcttccgggcgcggcaccccaatgtg
caactgcaactgcgcgaggccaccagcgatatccagctggaggccctgatggacggtggc
atcgacgccgggctggtgatccgcccgcaactgccggccatgccgcatggcgtggcctac
ctgccgctggtgcgcgagccgctggtgctggccgtgccgcagggctggcgcccggatggc
tcagcgggggcggccgacggaacggagcccggcgtttccctgaaagaggcggcgcacgag
ccgttgatcatctttccccggcgaagcgcgccggcgttttatgacatcattacgggctgt
tacgcgcgcgaaggccttacgccggtgattgcccaggaagccatccagatgcagacgatc
gtcagcctggtatccgccggcatgggcgtggcgctggtgccggcctcgctttgcaacctt
cgccgtaccggtgtgtcctacctgccgttgcgcggcgccgggcccgatatcgagacgggg
ctggtgtggcgtgaggctggtgccgacagcgtgagccccgtgctgagatcgttcatcgag
atcgccggcgcgctggccgctgccatgacgctgacgcaaaacgctggcataacaccgggc
acggagccgggcgcgcagcttggcactgccgctgcggcaacgcacctgacggacgcagcc
tga
DBGET
integrated database retrieval system