Cupriavidus basilensis: RR42_m4248
Help
Entry
RR42_m4248 CDS
T03642
Name
(GenBank) Inner membrane protein translocase component YidC, long form
KO
K03217
YidC/Oxa1 family membrane protein insertase
Organism
cbw
Cupriavidus basilensis
Pathway
cbw02024
Quorum sensing
cbw03060
Protein export
cbw03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
cbw00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
RR42_m4248
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
RR42_m4248
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
RR42_m4248
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
cbw03029
]
RR42_m4248
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
cbw02044
]
RR42_m4248
Mitochondrial biogenesis [BR:
cbw03029
]
Mitochondrial quality control factors
Mitochondrial respiratory chain complex assembly factors
Complex-IV assembly factors
RR42_m4248
Secretion system [BR:
cbw02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
RR42_m4248
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
YidC_periplas
60KD_IMP
Glyco_hydro_36N
ODAD1_CC
Motif
Other DBs
NCBI-ProteinID:
AJG21595
UniProt:
A0A0C4YFT0
LinkDB
All DBs
Position
main:complement(4519591..4521222)
Genome browser
AA seq
543 aa
AA seq
DB search
MALVLLYDNWQRANGHQSMFFPSATQQAPATAGGASAPQGDVPKANATAGTAAGAAASVP
VAAAQPSGEKIVVSTDVMRAQIDTAGGILTRLELLNHKDHDGKPVVLFERDQTRTYMARS
GLIGGDLPNHTTVFTASAGPRDLAGSDKVSVTLTAEKDGVKLDKTYTFHKGSYVVDTKFA
VTNDSGKPISPTLYMELTRDGSKVEQSQFYSTFTGPAIYTDADKYHKITFDDIGKGKASV
PAAGSSGWVAMVQHYFASAWIPQSGKEHSFYVEKIDNNLFRVGVQQPLGAIAPGATVSTD
ARLFAGPQEERMLEKITPGLELVKDYGWLTILAKPLFWLLEKIHGLLGNWGWSIIGLTVL
IKLVFFPLSAASYKSMGKMKDLQPRMTAMRERHKGDPQKMNQEMMALYRTEKVNPLGGCL
PIVIQIPVFIALYWVLLSSVEMRGAPWLGWIHDLSVPDPFYILPVLMAVSMFVQTKLNPT
PPDPVQAKVMMIMPLVFSFMFFFFPAGLVMYWVTNNVLSIAQQWQINRMLGKNKAKTAAV
AKG
NT seq
1632 nt
NT seq
+upstream
nt +downstream
nt
atggccctcgtgctgctctacgacaactggcagcgcgccaacggtcaccagtcgatgttc
ttcccgagcgcgacgcagcaggctccggcaaccgcaggcggcgcttcggccccgcaaggc
gacgtgcccaaggccaatgcaacagccggcaccgccgcgggcgccgcggcgtccgtcccg
gtcgccgcggcccagccgagcggcgagaagatcgtggtcagcaccgacgtgatgcgtgcc
cagatcgataccgccggcggtatcctgacgcgcctggaactgctgaaccacaaagaccat
gacggcaagccggtcgtgctgttcgagcgtgaccagacccgcacctacatggcccgttcc
ggcctgatcggtggcgacctgcccaaccacaccacggtgtttaccgcttcggcgggcccg
cgcgacctggctggctcggacaaggtgtcggtgacgctgacggcggagaaggacggggtc
aagctggacaagacctataccttccacaagggcagctacgttgtcgacacgaaatttgcc
gtgaccaacgacagcggcaagccgatctcgccgacgctgtacatggaactgacgcgcgac
ggcagcaaggtcgagcagtcgcagttctatagcaccttcaccggcccggccatctacacc
gacgccgacaagtaccacaagatcaccttcgacgacatcggcaagggcaaggcttcggtc
cccgcggccggtagcagcggctgggtggcgatggtgcagcattactttgcctcggcgtgg
attccgcaatcgggcaaggagcacagcttctacgtcgagaagatcgacaacaacctgttc
cgcgtgggcgtgcagcagccgctgggcgccatcgccccgggcgccacggtatccaccgat
gcgcgcctgttcgccggcccgcaggaagagcgcatgctcgagaagatcaccccgggcctg
gaactggtgaaggactacggatggctgaccatcctggccaagccgctgttctggctgctg
gagaaaatccacggcttgctgggcaactggggctggtcgatcatcgggctgaccgtgctg
atcaagctggtgttcttcccgctgtccgcggctagctacaagtccatgggcaagatgaag
gacctgcagccccgcatgaccgcgatgcgcgagcgccacaagggcgatccgcagaagatg
aaccaggagatgatggcgctgtaccgcaccgagaaggtcaacccgctgggcggctgcctg
cccatcgtgatccagatcccggtgttcattgcgctgtactgggtgctgctgtcgtcggtg
gaaatgcgcggtgcgccttggctgggctggatccatgacctgtcggtgccggatccgttc
tacatcctgccggtgctgatggccgtgtcgatgttcgtgcagaccaagctgaacccgacc
ccgccggaccccgtgcaggccaaggtcatgatgatcatgccgctggtgttctcgttcatg
ttcttcttcttcccggctggcctggtgatgtactgggtcaccaacaacgtcttgtcgatc
gcgcagcaatggcagatcaaccggatgcttggcaagaacaaggcgaagaccgcggcggtg
gccaagggctga
DBGET
integrated database retrieval system