Candidatus Symbiobacter mobilis: Cenrod_0762 Help Entry Cenrod_0762       CDS       T02877                                  Symbol acpP Name (GenBank) acyl-carrier protein   KO K02078   acyl carrier protein Organism cbx  Candidatus Symbiobacter mobilis Pathway cbx01100   Metabolic pathways cbx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cbx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Cenrod_0762 (acpP)    00074 Mycolic acid biosynthesis     Cenrod_0762 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Cenrod_0762 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AGX86868 UniProt:  U5N9G2 LinkDB All DBs Position 821532..821771 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIISEQLGTDESKITNDKAFVGDLGADSLDTVELVMALEDEFGIEIPDEDA EQITTVQHAIDYALEHASK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatattgaagcacgtgtaaagaaaatcatttccgagcaactcggtactgacgaa tccaaaatcaccaatgacaaagccttcgtgggcgatctgggtgccgattcgctcgatacc gttgaactcgtcatggcgcttgaagacgagttcggtatcgagattccagatgaggatgcc gagcaaatcactactgtgcagcatgccatcgattacgctttggagcatgccagcaaataa

DBGET integrated database retrieval system