Candidatus Symbiobacter mobilis: Cenrod_2127 Help Entry Cenrod_2127       CDS       T02877                                  Symbol groES Name (GenBank) chaperonin GroES   KO K04078   chaperonin GroES Organism cbx  Candidatus Symbiobacter mobilis Brite KEGG Orthology (KO) [BR:cbx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cbx03110]     Cenrod_2127 (groES)    03029 Mitochondrial biogenesis [BR:cbx03029]     Cenrod_2127 (groES) Chaperones and folding catalysts [BR:cbx03110]  Heat shock proteins   HSP10    Cenrod_2127 (groES) Mitochondrial biogenesis [BR:cbx03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     Cenrod_2127 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 ExoX-like_C Motif Other DBs NCBI-ProteinID:  AGX88198 UniProt:  U5ND74 LinkDB All DBs Position 2348779..2349069 Genome browser AA seq 96 aa AA seqDB search MKLRPLHDRVIVKRVENETKTASGIVIPDSAAEKPDQGEVLAVGPGKKNDKGELGAMSVK VGDRVLFGKYSGQTVKVDGDELLVMKEDDLFAVVEK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaaacttcgtcccttgcacgaccgcgtgatcgtcaaacgtgtcgaaaacgaaaccaaa acggcctcgggcatcgtcattcccgacagcgccgctgaaaagcccgatcaaggcgaagtc cttgccgtaggcccgggcaagaagaacgacaaaggcgagcttggcgcgatgagcgtgaag gtcggtgaccgcgtgctcttcggcaaatacagcggccagaccgtcaaggtcgacggtgac gagcttctcgtcatgaaagaagacgatctgttcgcagtcgtcgagaagtaa

DBGET integrated database retrieval system