Clostridium cadaveris: KQH81_07310 Help Entry KQH81_07310       CDS       T07934                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccaa  Clostridium cadaveris Pathway ccaa00998   Biosynthesis of various antibiotics ccaa01100   Metabolic pathways ccaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KQH81_07310    00074 Mycolic acid biosynthesis     KQH81_07310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KQH81_07310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C FtsA Motif Other DBs NCBI-ProteinID:  UFH66317 LinkDB All DBs Position 1579973..1580194 Genome browser AA seq 73 aa AA seqDB search MVFEKVKEIVVEQLGLEGNEITEETSFDSLGVDSLDLFQIIIEIEEAFNIQIENAEEMKT VKDAVKYIESKIA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggtatttgaaaaggttaaggaaatagttgtggaacaattaggtttagaaggaaatgaa ataacagaggaaacatcttttgatagtttaggagtagattctttagatttattccaaata ataattgaaatagaagaggcatttaatattcaaattgaaaatgcagaagaaatgaagact gttaaagatgcagttaagtatattgaaagtaaaatagcataa

DBGET integrated database retrieval system