Cervus canadensis (wapiti): 122421012 Help Entry 122421012         CDS       T07554                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism ccad  Cervus canadensis (wapiti) Pathway ccad04010   MAPK signaling pathway ccad04014   Ras signaling pathway ccad04015   Rap1 signaling pathway ccad04024   cAMP signaling pathway ccad04072   Phospholipase D signaling pathway ccad04137   Mitophagy - animal ccad04140   Autophagy - animal ccad04218   Cellular senescence ccad04360   Axon guidance ccad04371   Apelin signaling pathway ccad04625   C-type lectin receptor signaling pathway ccad04810   Regulation of actin cytoskeleton ccad05132   Salmonella infection ccad05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122421012 (RRAS)    04014 Ras signaling pathway     122421012 (RRAS)    04015 Rap1 signaling pathway     122421012 (RRAS)    04371 Apelin signaling pathway     122421012 (RRAS)    04072 Phospholipase D signaling pathway     122421012 (RRAS)    04024 cAMP signaling pathway     122421012 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122421012 (RRAS)    04137 Mitophagy - animal     122421012 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     122421012 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122421012 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122421012 (RRAS)   09158 Development and regeneration    04360 Axon guidance     122421012 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     122421012 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     122421012 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ccad04031]     122421012 (RRAS) GTP-binding proteins [BR:ccad04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122421012 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  122421012 NCBI-ProteinID:  XP_043292641 LinkDB All DBs Position 18:complement(20965913..20969769) Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGVPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKARGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggtgccggga cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actattgaagactcctacacgaagatctgcactgtggatggcgtgccagcccggctagac atcctggacaccgctggccaggaggaatttggtgccatgcgggaacagtacatgcgtgca ggccacggcttcctgctggtgtttgccattaatgacaggcagagtttcaacgaagtgggc aagcttttcacacagatccttcgagtcaaggaccgagacgacttccccgtcgtgttggtt ggcaacaaggcagatctggaaacacagcgccaggtcccccgatctgaagcctccaccttc agtgcctcccaccacgtggcctacttcgaagcttccgccaaactgcgcctcaatgtggat gaggccttcgagcagctggtgcgggccgtccggaagtaccaggaacaagagctcccgccc tccccgcccagcgcccccaggaagaaggccagaggctgcccctgtgtcctcctgtag

DBGET integrated database retrieval system