Cervus canadensis (wapiti): 122421350
Help
Entry
122421350 CDS
T07554
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
ccad
Cervus canadensis (wapiti)
Pathway
ccad03050
Proteasome
ccad05010
Alzheimer disease
ccad05012
Parkinson disease
ccad05014
Amyotrophic lateral sclerosis
ccad05016
Huntington disease
ccad05017
Spinocerebellar ataxia
ccad05020
Prion disease
ccad05022
Pathways of neurodegeneration - multiple diseases
ccad05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
ccad00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
122421350 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
122421350 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
122421350 (PSMD7)
05012 Parkinson disease
122421350 (PSMD7)
05014 Amyotrophic lateral sclerosis
122421350 (PSMD7)
05016 Huntington disease
122421350 (PSMD7)
05017 Spinocerebellar ataxia
122421350 (PSMD7)
05020 Prion disease
122421350 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
122421350 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
ccad03051
]
122421350 (PSMD7)
Proteasome [BR:
ccad03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
122421350 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Motif
Other DBs
NCBI-GeneID:
122421350
NCBI-ProteinID:
XP_043293154
LinkDB
All DBs
Position
18:35511420..35520063
Genome browser
AA seq
322 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRGYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEDSKKDR
KDDKEKEKEKSDVKKEEKKEKK
NT seq
969 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaatcgaataggcaaggttggaaaccaaaaacgtgttgttggtgtgcttttg
gggtcgtggcaaaagaaagtacttgatgtatccaacagttttgcagttccttttgatgaa
gacgacaaagatgattctgtctggtttttagaccatgattacttggaaaacatgtatgga
atgtttaagaaggtcaacgccagagaaagaatagttgggtggtaccacacaggccctaaa
ctacacaagaatgacatcgccatcaatgaacttatgaaaagatactgccctaactcagta
ttggtcatcattgatgtgaagccaaaggacctgggactgcccacagaagcatatatttcg
gtggaagaagttcatgatgatggaactccaacctcaaaaacatttgagcacgtgaccagt
gaaattggagccgaggaagccgaggaagtcggagttgaacacttgttacgagacatcaaa
gacactacagtgggcactctttcccagcggatcacaaaccaggtccatggtctgaaggga
ctcaactccaagctcctggacatcaggggctacctggagaaggtggccactggcaagctg
cccatcaaccaccagatcatctaccagctgcaggatgtcttcaacctgctgccagatgtc
agcctgcaggaatttgtcaaggccttttacctgaagaccaacgatcagatggtggtggta
tatttggcctcactgatccgttctgtggtcgccttgcacaacctcatcaacaacaagatt
gccaaccgggatgcagaaaagaaagaagggcaagaaaaggaagacagcaaaaaggataga
aaagacgacaaagagaaagagaaggaaaagagtgatgtaaagaaagaagagaaaaaggag
aaaaaataa
DBGET
integrated database retrieval system