Cervus canadensis (wapiti): 122424281 Help Entry 122424281         CDS       T07554                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ccad  Cervus canadensis (wapiti) Pathway ccad04137   Mitophagy - animal ccad04140   Autophagy - animal ccad04144   Endocytosis ccad04145   Phagosome ccad04148   Efferocytosis ccad05132   Salmonella infection ccad05146   Amoebiasis ccad05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ccad00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122424281 (RAB7A)    04145 Phagosome     122424281 (RAB7A)    04140 Autophagy - animal     122424281 (RAB7A)    04137 Mitophagy - animal     122424281 (RAB7A)    04148 Efferocytosis     122424281 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122424281 (RAB7A)    05152 Tuberculosis     122424281 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     122424281 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccad04131]     122424281 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccad04147]     122424281 (RAB7A)    04031 GTP-binding proteins [BR:ccad04031]     122424281 (RAB7A) Membrane trafficking [BR:ccad04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     122424281 (RAB7A) Exosome [BR:ccad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122424281 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    122424281 (RAB7A)   Exosomal proteins of colorectal cancer cells    122424281 (RAB7A)   Exosomal proteins of bladder cancer cells    122424281 (RAB7A) GTP-binding proteins [BR:ccad04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     122424281 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  122424281 NCBI-ProteinID:  XP_043297834 LinkDB All DBs Position 22:1489688..1532914 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRTKPAAEGCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcgaggaagaaagtgctgttgaaggtgatcatcctgggagactctggagtcggg aagacctcactcatgaaccagtatgtgaacaagaagttcagtaaccagtacaaagccaca ataggggcagacttcctgacgaaggaggtgatggtggacgacaggctagtgaccatgcag atctgggacacggctggacaggagcggttccagtccctgggcgtggccttctacagaggt gccgactgctgcgttctggtgttcgacgtgaccgcccccaacaccttcaagacccttgac agctggagagacgagtttctcatccaggccagtccccgggaccccgagaacttccccttt gtcgtgttgggaaacaagattgatctcgaaaacagacaggtggccaccaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagcgccaaggaggccatc aacgtggagcaggccttccagacgatcgcccggaacgcgctcaagcaggaaactgaggtg gagctgtacaacgagttccccgagcccatcaaactggacaagaacgaccgcaccaagccc gcggccgagggctgcagctgctga

DBGET integrated database retrieval system