Cervus canadensis (wapiti): 122424693 Help Entry 122424693         CDS       T07554                                  Symbol GHRL Name (RefSeq) appetite-regulating hormone   KO K05254   ghrelin Organism ccad  Cervus canadensis (wapiti) Pathway ccad04024   cAMP signaling pathway ccad04080   Neuroactive ligand-receptor interaction ccad04081   Hormone signaling ccad04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     122424693 (GHRL)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     122424693 (GHRL)    04081 Hormone signaling     122424693 (GHRL)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     122424693 (GHRL)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122424693 (GHRL) Cytokines and neuropeptides [BR:ccad04052]  Neuropeptides   GPCR binding    122424693 (GHRL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Motilin_assoc Motilin_ghrelin Motif Other DBs NCBI-GeneID:  122424693 NCBI-ProteinID:  XP_043298713 LinkDB All DBs Position 22:6282804..6286911 Genome browser AA seq 116 aa AA seqDB search MPAPWTVCSLLLLSVLWLDLAMAGSSFLSPEHQKLQRKEPKKPSGRLKPRALEGQFDPEV GSQAEGAEDELEIRFNAPFDIGIKLSGAQSLQHGQTLGKFLQDILWEEADETLADE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgcctgccccatggaccgtctgcagcctgctgctgctcagcgtgctctggctggacttg gccatggcgggctccagctttctgagccccgaacatcagaaactgcagagaaaggaacct aagaagccatcaggcagactgaagccccgggccctggaaggccagtttgacccggaggtg ggaagtcaggcggaaggtgcagaggacgagctggaaatccggttcaacgccccctttgac attgggatcaagctgtcaggggctcagtccctccagcatggccagacgctggggaagttt cttcaggacatcctttgggaagaagccgacgaaaccctggctgatgagtga

DBGET integrated database retrieval system