Cervus canadensis (wapiti): 122429195 Help Entry 122429195         CDS       T07554                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism ccad  Cervus canadensis (wapiti) Pathway ccad04613   Neutrophil extracellular trap formation ccad05034   Alcoholism ccad05203   Viral carcinogenesis ccad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122429195  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     122429195   09163 Immune disease    05322 Systemic lupus erythematosus     122429195   09165 Substance dependence    05034 Alcoholism     122429195  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccad03036]     122429195 Chromosome and associated proteins [BR:ccad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122429195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  122429195 NCBI-ProteinID:  XP_043305372 LinkDB All DBs Position 28:complement(23365020..23366012) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggtaagggtggtaaaggccttggtaagggaggcgctaagcgccatcgc aaagtcttgcgggacaatatccagggtattactaagccagctatccggcgtcttgctcgg cgtggtggggtcaaacgtatctccggtcttatctacgaagagactcgtggggtgctgaaa gtgtttctggaaaatgtgatccgtgacgcggtcacctacacggagcacgccaagcgcaag actgttaccgccatggacgtcgtctacgcgctcaaacgtcagggccgtactctttacggt tttggtggttga

DBGET integrated database retrieval system