Cervus canadensis (wapiti): 122429584 Help Entry 122429584         CDS       T07554                                  Name (RefSeq) glutathione S-transferase A4   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism ccad  Cervus canadensis (wapiti) Pathway ccad00480   Glutathione metabolism ccad00980   Metabolism of xenobiotics by cytochrome P450 ccad00982   Drug metabolism - cytochrome P450 ccad00983   Drug metabolism - other enzymes ccad01100   Metabolic pathways ccad01524   Platinum drug resistance ccad05200   Pathways in cancer ccad05204   Chemical carcinogenesis - DNA adducts ccad05207   Chemical carcinogenesis - receptor activation ccad05208   Chemical carcinogenesis - reactive oxygen species ccad05225   Hepatocellular carcinoma ccad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     122429584   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     122429584    00982 Drug metabolism - cytochrome P450     122429584    00983 Drug metabolism - other enzymes     122429584  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122429584    05204 Chemical carcinogenesis - DNA adducts     122429584    05207 Chemical carcinogenesis - receptor activation     122429584    05208 Chemical carcinogenesis - reactive oxygen species     122429584   09162 Cancer: specific types    05225 Hepatocellular carcinoma     122429584   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     122429584   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     122429584  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ccad02000]     122429584 Enzymes [BR:ccad01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      122429584 Transporters [BR:ccad02000]  Other transporters   Pores ion channels [TC:1]    122429584 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  122429584 NCBI-ProteinID:  XP_043305959 LinkDB All DBs Position 28:26629434..26642836 Genome browser AA seq 222 aa AA seqDB search MATKPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVEI DGMKLVQTRSILHYIADKHHLFGKDLKERTLIDMYVEGTLDLLELLILHPFLKPDDQQKE VANMAQKAIIRYFPVFEKVLQGHGQRFLVGDQLSLADIILLQTILALEEKIPNILSAFPH LQEYTVKISNIPTIKKFLEPGSKKKPPPDDIYVRTVYTVFMP NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggccacgaaacccaagctccactatcccaacggacgaggccggatggaatccgtgcga tgggtgttagctgctgccggagtcgagtttgatgaagaatttttagaaacaaaagaacag ttgcagaagttgcaggatggtaaccacctgctgttccaacaagtgccaatggttgaaatt gatgggatgaagctggtgcagacccggagcatcctccactacatcgcagacaagcaccat ctcttcggcaaagacctcaaggagagaaccctgattgacatgtatgtggaggggaccctg gatcttctggaactgcttatcttgcatcctttcctcaaaccagacgatcagcaaaaggaa gtggctaacatggcccagaaggctataattagatactttcctgtgttcgaaaaggtttta cagggtcatggacaaaggtttcttgttggggatcagctgagccttgcagatataattcta ctccagaccattttggctctagaagagaaaattcctaatatcctatctgccttccctcac ctccaggagtacacagtgaagatcagtaatatccctacaattaagaagttccttgaacct ggcagcaagaagaaacctccccctgatgacatctacgtgagaaccgtgtacaccgtcttc atgccgtag

DBGET integrated database retrieval system