Cervus canadensis (wapiti): 122430569 Help Entry 122430569         CDS       T07554                                  Symbol CFL1 Name (RefSeq) cofilin-1 isoform X1   KO K05765   cofilin Organism ccad  Cervus canadensis (wapiti) Pathway ccad04360   Axon guidance ccad04666   Fc gamma R-mediated phagocytosis ccad04810   Regulation of actin cytoskeleton ccad05133   Pertussis ccad05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:ccad00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122430569 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     122430569 (CFL1)   09158 Development and regeneration    04360 Axon guidance     122430569 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122430569 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     122430569 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccad04131]     122430569 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccad04812]     122430569 (CFL1)    04147 Exosome [BR:ccad04147]     122430569 (CFL1) Membrane trafficking [BR:ccad04131]  Others   Actin-binding proteins    Others     122430569 (CFL1) Cytoskeleton proteins [BR:ccad04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      122430569 (CFL1) Exosome [BR:ccad04147]  Exosomal proteins   Proteins found in most exosomes    122430569 (CFL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  122430569 NCBI-ProteinID:  XP_043307145 LinkDB All DBs Position 29:complement(41404860..41408411) Genome browser AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctccggtgtggctgtgtctgatggggtcatcaaagtgttcaacgacatgaaagtg cgtaagtcgtcgacaccagaggaagtgaagaagcgcaagaaggcggtgctcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggtgacgtg ggccagacggtagacgacccttatgccacctttgtcaagatgctgccagacaaggactgc cgctacgccctctatgacgcaacctacgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggcccctgagtgtgcaccccttaagagcaaaatgatctatgccagctcc aaggatgccatcaagaagaagctgacggggatcaagcatgaattacaagcaaactgctac gaagaggtcaaggaccgctgcacccttgcagagaagctggggggcagcgccgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system