Cervus canadensis (wapiti): 122430981 Help Entry 122430981         CDS       T07554                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism ccad  Cervus canadensis (wapiti) Pathway ccad04010   MAPK signaling pathway ccad04014   Ras signaling pathway ccad04015   Rap1 signaling pathway ccad04022   cGMP-PKG signaling pathway ccad04066   HIF-1 signaling pathway ccad04068   FoxO signaling pathway ccad04072   Phospholipase D signaling pathway ccad04081   Hormone signaling ccad04114   Oocyte meiosis ccad04140   Autophagy - animal ccad04150   mTOR signaling pathway ccad04151   PI3K-Akt signaling pathway ccad04152   AMPK signaling pathway ccad04211   Longevity regulating pathway ccad04213   Longevity regulating pathway - multiple species ccad04810   Regulation of actin cytoskeleton ccad04910   Insulin signaling pathway ccad04911   Insulin secretion ccad04913   Ovarian steroidogenesis ccad04914   Progesterone-mediated oocyte maturation ccad04917   Prolactin signaling pathway ccad04923   Regulation of lipolysis in adipocytes ccad04930   Type II diabetes mellitus ccad04931   Insulin resistance ccad04932   Non-alcoholic fatty liver disease ccad04940   Type I diabetes mellitus ccad04950   Maturity onset diabetes of the young ccad04960   Aldosterone-regulated sodium reabsorption ccad05010   Alzheimer disease ccad05215   Prostate cancer ccad05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122430981 (INS)    04014 Ras signaling pathway     122430981 (INS)    04015 Rap1 signaling pathway     122430981 (INS)    04066 HIF-1 signaling pathway     122430981 (INS)    04068 FoxO signaling pathway     122430981 (INS)    04072 Phospholipase D signaling pathway     122430981 (INS)    04022 cGMP-PKG signaling pathway     122430981 (INS)    04151 PI3K-Akt signaling pathway     122430981 (INS)    04152 AMPK signaling pathway     122430981 (INS)    04150 mTOR signaling pathway     122430981 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     122430981 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122430981 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     122430981 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122430981 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     122430981 (INS)    04910 Insulin signaling pathway     122430981 (INS)    04923 Regulation of lipolysis in adipocytes     122430981 (INS)    04913 Ovarian steroidogenesis     122430981 (INS)    04914 Progesterone-mediated oocyte maturation     122430981 (INS)    04917 Prolactin signaling pathway     122430981 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     122430981 (INS)   09149 Aging    04211 Longevity regulating pathway     122430981 (INS)    04213 Longevity regulating pathway - multiple species     122430981 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     122430981 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     122430981 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     122430981 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     122430981 (INS)    04940 Type I diabetes mellitus     122430981 (INS)    04950 Maturity onset diabetes of the young     122430981 (INS)    04932 Non-alcoholic fatty liver disease     122430981 (INS)    04931 Insulin resistance     122430981 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122430981 (INS) Cytokines and neuropeptides [BR:ccad04052]  Neuropeptides   Unclassified    122430981 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  122430981 NCBI-ProteinID:  XP_043307923 LinkDB All DBs Position 29:complement(45519859..45520997) Genome browser AA seq 105 aa AA seqDB search MALWTRLLPLLALLALCAPAPAGAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVDG PQVGALELAGGPGAGGLEGPPQKRGIVEQCCTSICSLYQLENYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacgcgcctgctgcccctgctggccctgctggcgctctgcgcccccgcc ccggccggcgccttcgtcaaccagcacctgtgcggctcccacctggtggaggctctgtac ctcgtgtgcggggagcgaggcttcttctacacgcccaaggcccgccgggaggtggacggc ccccaggtgggggcgctggagctggcgggcggccccggcgcgggcggcctggaggggccc ccgcagaagcgcggcatcgtggagcagtgctgcaccagcatctgctcgctctaccagctg gagaactactgcaactag

DBGET integrated database retrieval system