Cervus canadensis (wapiti): 122431410 Help Entry 122431410         CDS       T07554                                  Symbol FGF4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism ccad  Cervus canadensis (wapiti) Pathway ccad04010   MAPK signaling pathway ccad04014   Ras signaling pathway ccad04015   Rap1 signaling pathway ccad04020   Calcium signaling pathway ccad04151   PI3K-Akt signaling pathway ccad04810   Regulation of actin cytoskeleton ccad05200   Pathways in cancer ccad05207   Chemical carcinogenesis - receptor activation ccad05218   Melanoma ccad05224   Breast cancer ccad05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122431410 (FGF4)    04014 Ras signaling pathway     122431410 (FGF4)    04015 Rap1 signaling pathway     122431410 (FGF4)    04020 Calcium signaling pathway     122431410 (FGF4)    04151 PI3K-Akt signaling pathway     122431410 (FGF4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122431410 (FGF4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122431410 (FGF4)    05207 Chemical carcinogenesis - receptor activation     122431410 (FGF4)   09162 Cancer: specific types    05226 Gastric cancer     122431410 (FGF4)    05218 Melanoma     122431410 (FGF4)    05224 Breast cancer     122431410 (FGF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122431410 (FGF4)    00536 Glycosaminoglycan binding proteins [BR:ccad00536]     122431410 (FGF4) Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Growth factors (RTK binding)    122431410 (FGF4) Glycosaminoglycan binding proteins [BR:ccad00536]  Heparan sulfate / Heparin   Growth factors/receptors    122431410 (FGF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  122431410 NCBI-ProteinID:  XP_043308662 LinkDB All DBs Position 29:47868163..47870077 Genome browser AA seq 206 aa AA seqDB search MAGPGAAAAALLPAVLLAVLAPWAGRGGAAAPTAPNGTLEAELERRWESLVARSLARLPV AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLSDGRIGGVHADTSDSLLELSP VERGVVSIFGVASRFFVAMSSRGRLYGSPFFTDECKFKEILLPNNYNAYECYRYPGMFIA LSKNGKTKKGNRVSPTMKVTHFLPRL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcggggcccggggcggccgcggcagcgctgctcccggcggtgctgctggccgtgctg gcgccctgggccggccgagggggcgccgccgcgcccaccgcccccaacggcacgctggag gccgagctggagcgccgttgggagagcctggtggctcgctcgctggcgcgcctgccagtg gccgcgcagcccaaggaggctgccgtccagagcggcgccggcgattacttgctgggcatc aagcggctgcggaggctgtactgcaacgtgggcatcggcttccacctccaggtgctctcc gacggccgcatcggcggcgtgcacgcggacacgagtgacagcctgctggagctgtcgccg gtggagcgcggggtggtgagcattttcggggtagccagccggttcttcgtggccatgagc agccggggcaggctctacggctcgccttttttcaccgacgagtgcaagttcaaagagatc ctcctccccaacaactacaacgcctacgagtgctaccggtaccccggcatgttcatcgcc ctgagtaagaacgggaagaccaagaaggggaaccgggtgtcccccaccatgaaggtcacc cactttctccccaggctgtga

DBGET integrated database retrieval system