Cervus canadensis (wapiti): 122431926 Help Entry 122431926         CDS       T07554                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism ccad  Cervus canadensis (wapiti) Pathway ccad04621   NOD-like receptor signaling pathway ccad05012   Parkinson disease ccad05132   Salmonella infection ccad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     122431926 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122431926 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     122431926 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     122431926 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ccad03110]     122431926 (TXN) Chaperones and folding catalysts [BR:ccad03110]  Protein folding catalysts   Protein disulfide isomerase    122431926 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  122431926 NCBI-ProteinID:  XP_043309517 LinkDB All DBs Position 30:complement(31998385..32010417) Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVAAECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagattgagagcaagtacgcttttcaggaagccttgaacagtgcaggagag aaactcgtagtagtcgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttcttccattctctctctgaaaagtattccaacgtggtgttcctggaagtagatgtggat gactgtcaggatgttgctgcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaggaaaaacttgaagccacc attaatgaattaatctaa

DBGET integrated database retrieval system