KEGG   Cervus canadensis (wapiti): 122433033
Entry
122433033         CDS       T07554                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ccad  Cervus canadensis (wapiti)
Pathway
ccad01521  EGFR tyrosine kinase inhibitor resistance
ccad01522  Endocrine resistance
ccad01524  Platinum drug resistance
ccad04010  MAPK signaling pathway
ccad04012  ErbB signaling pathway
ccad04014  Ras signaling pathway
ccad04015  Rap1 signaling pathway
ccad04022  cGMP-PKG signaling pathway
ccad04024  cAMP signaling pathway
ccad04062  Chemokine signaling pathway
ccad04066  HIF-1 signaling pathway
ccad04068  FoxO signaling pathway
ccad04071  Sphingolipid signaling pathway
ccad04072  Phospholipase D signaling pathway
ccad04114  Oocyte meiosis
ccad04140  Autophagy - animal
ccad04148  Efferocytosis
ccad04150  mTOR signaling pathway
ccad04151  PI3K-Akt signaling pathway
ccad04210  Apoptosis
ccad04218  Cellular senescence
ccad04261  Adrenergic signaling in cardiomyocytes
ccad04270  Vascular smooth muscle contraction
ccad04350  TGF-beta signaling pathway
ccad04360  Axon guidance
ccad04370  VEGF signaling pathway
ccad04371  Apelin signaling pathway
ccad04380  Osteoclast differentiation
ccad04510  Focal adhesion
ccad04517  IgSF CAM signaling
ccad04520  Adherens junction
ccad04540  Gap junction
ccad04550  Signaling pathways regulating pluripotency of stem cells
ccad04611  Platelet activation
ccad04613  Neutrophil extracellular trap formation
ccad04620  Toll-like receptor signaling pathway
ccad04621  NOD-like receptor signaling pathway
ccad04625  C-type lectin receptor signaling pathway
ccad04650  Natural killer cell mediated cytotoxicity
ccad04657  IL-17 signaling pathway
ccad04658  Th1 and Th2 cell differentiation
ccad04659  Th17 cell differentiation
ccad04660  T cell receptor signaling pathway
ccad04662  B cell receptor signaling pathway
ccad04664  Fc epsilon RI signaling pathway
ccad04666  Fc gamma R-mediated phagocytosis
ccad04668  TNF signaling pathway
ccad04713  Circadian entrainment
ccad04720  Long-term potentiation
ccad04722  Neurotrophin signaling pathway
ccad04723  Retrograde endocannabinoid signaling
ccad04724  Glutamatergic synapse
ccad04725  Cholinergic synapse
ccad04726  Serotonergic synapse
ccad04730  Long-term depression
ccad04810  Regulation of actin cytoskeleton
ccad04910  Insulin signaling pathway
ccad04912  GnRH signaling pathway
ccad04914  Progesterone-mediated oocyte maturation
ccad04915  Estrogen signaling pathway
ccad04916  Melanogenesis
ccad04917  Prolactin signaling pathway
ccad04919  Thyroid hormone signaling pathway
ccad04921  Oxytocin signaling pathway
ccad04926  Relaxin signaling pathway
ccad04928  Parathyroid hormone synthesis, secretion and action
ccad04929  GnRH secretion
ccad04930  Type II diabetes mellitus
ccad04933  AGE-RAGE signaling pathway in diabetic complications
ccad04934  Cushing syndrome
ccad04935  Growth hormone synthesis, secretion and action
ccad04960  Aldosterone-regulated sodium reabsorption
ccad05010  Alzheimer disease
ccad05020  Prion disease
ccad05022  Pathways of neurodegeneration - multiple diseases
ccad05034  Alcoholism
ccad05132  Salmonella infection
ccad05133  Pertussis
ccad05135  Yersinia infection
ccad05140  Leishmaniasis
ccad05142  Chagas disease
ccad05145  Toxoplasmosis
ccad05152  Tuberculosis
ccad05160  Hepatitis C
ccad05161  Hepatitis B
ccad05163  Human cytomegalovirus infection
ccad05164  Influenza A
ccad05165  Human papillomavirus infection
ccad05166  Human T-cell leukemia virus 1 infection
ccad05167  Kaposi sarcoma-associated herpesvirus infection
ccad05170  Human immunodeficiency virus 1 infection
ccad05171  Coronavirus disease - COVID-19
ccad05200  Pathways in cancer
ccad05203  Viral carcinogenesis
ccad05205  Proteoglycans in cancer
ccad05206  MicroRNAs in cancer
ccad05207  Chemical carcinogenesis - receptor activation
ccad05208  Chemical carcinogenesis - reactive oxygen species
ccad05210  Colorectal cancer
ccad05211  Renal cell carcinoma
ccad05212  Pancreatic cancer
ccad05213  Endometrial cancer
ccad05214  Glioma
ccad05215  Prostate cancer
ccad05216  Thyroid cancer
ccad05218  Melanoma
ccad05219  Bladder cancer
ccad05220  Chronic myeloid leukemia
ccad05221  Acute myeloid leukemia
ccad05223  Non-small cell lung cancer
ccad05224  Breast cancer
ccad05225  Hepatocellular carcinoma
ccad05226  Gastric cancer
ccad05230  Central carbon metabolism in cancer
ccad05231  Choline metabolism in cancer
ccad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ccad05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    122433033 (MAPK3)
   04012 ErbB signaling pathway
    122433033 (MAPK3)
   04014 Ras signaling pathway
    122433033 (MAPK3)
   04015 Rap1 signaling pathway
    122433033 (MAPK3)
   04350 TGF-beta signaling pathway
    122433033 (MAPK3)
   04370 VEGF signaling pathway
    122433033 (MAPK3)
   04371 Apelin signaling pathway
    122433033 (MAPK3)
   04668 TNF signaling pathway
    122433033 (MAPK3)
   04066 HIF-1 signaling pathway
    122433033 (MAPK3)
   04068 FoxO signaling pathway
    122433033 (MAPK3)
   04072 Phospholipase D signaling pathway
    122433033 (MAPK3)
   04071 Sphingolipid signaling pathway
    122433033 (MAPK3)
   04024 cAMP signaling pathway
    122433033 (MAPK3)
   04022 cGMP-PKG signaling pathway
    122433033 (MAPK3)
   04151 PI3K-Akt signaling pathway
    122433033 (MAPK3)
   04150 mTOR signaling pathway
    122433033 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    122433033 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    122433033 (MAPK3)
   04148 Efferocytosis
    122433033 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    122433033 (MAPK3)
   04210 Apoptosis
    122433033 (MAPK3)
   04218 Cellular senescence
    122433033 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    122433033 (MAPK3)
   04520 Adherens junction
    122433033 (MAPK3)
   04540 Gap junction
    122433033 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    122433033 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122433033 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    122433033 (MAPK3)
   04613 Neutrophil extracellular trap formation
    122433033 (MAPK3)
   04620 Toll-like receptor signaling pathway
    122433033 (MAPK3)
   04621 NOD-like receptor signaling pathway
    122433033 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    122433033 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    122433033 (MAPK3)
   04660 T cell receptor signaling pathway
    122433033 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    122433033 (MAPK3)
   04659 Th17 cell differentiation
    122433033 (MAPK3)
   04657 IL-17 signaling pathway
    122433033 (MAPK3)
   04662 B cell receptor signaling pathway
    122433033 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    122433033 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    122433033 (MAPK3)
   04062 Chemokine signaling pathway
    122433033 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    122433033 (MAPK3)
   04929 GnRH secretion
    122433033 (MAPK3)
   04912 GnRH signaling pathway
    122433033 (MAPK3)
   04915 Estrogen signaling pathway
    122433033 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    122433033 (MAPK3)
   04917 Prolactin signaling pathway
    122433033 (MAPK3)
   04921 Oxytocin signaling pathway
    122433033 (MAPK3)
   04926 Relaxin signaling pathway
    122433033 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    122433033 (MAPK3)
   04919 Thyroid hormone signaling pathway
    122433033 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    122433033 (MAPK3)
   04916 Melanogenesis
    122433033 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    122433033 (MAPK3)
   04270 Vascular smooth muscle contraction
    122433033 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    122433033 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    122433033 (MAPK3)
   04725 Cholinergic synapse
    122433033 (MAPK3)
   04726 Serotonergic synapse
    122433033 (MAPK3)
   04720 Long-term potentiation
    122433033 (MAPK3)
   04730 Long-term depression
    122433033 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    122433033 (MAPK3)
   04722 Neurotrophin signaling pathway
    122433033 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    122433033 (MAPK3)
   04380 Osteoclast differentiation
    122433033 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    122433033 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122433033 (MAPK3)
   05206 MicroRNAs in cancer
    122433033 (MAPK3)
   05205 Proteoglycans in cancer
    122433033 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    122433033 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    122433033 (MAPK3)
   05203 Viral carcinogenesis
    122433033 (MAPK3)
   05230 Central carbon metabolism in cancer
    122433033 (MAPK3)
   05231 Choline metabolism in cancer
    122433033 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    122433033 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    122433033 (MAPK3)
   05212 Pancreatic cancer
    122433033 (MAPK3)
   05225 Hepatocellular carcinoma
    122433033 (MAPK3)
   05226 Gastric cancer
    122433033 (MAPK3)
   05214 Glioma
    122433033 (MAPK3)
   05216 Thyroid cancer
    122433033 (MAPK3)
   05221 Acute myeloid leukemia
    122433033 (MAPK3)
   05220 Chronic myeloid leukemia
    122433033 (MAPK3)
   05218 Melanoma
    122433033 (MAPK3)
   05211 Renal cell carcinoma
    122433033 (MAPK3)
   05219 Bladder cancer
    122433033 (MAPK3)
   05215 Prostate cancer
    122433033 (MAPK3)
   05213 Endometrial cancer
    122433033 (MAPK3)
   05224 Breast cancer
    122433033 (MAPK3)
   05223 Non-small cell lung cancer
    122433033 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    122433033 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    122433033 (MAPK3)
   05161 Hepatitis B
    122433033 (MAPK3)
   05160 Hepatitis C
    122433033 (MAPK3)
   05171 Coronavirus disease - COVID-19
    122433033 (MAPK3)
   05164 Influenza A
    122433033 (MAPK3)
   05163 Human cytomegalovirus infection
    122433033 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    122433033 (MAPK3)
   05165 Human papillomavirus infection
    122433033 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    122433033 (MAPK3)
   05135 Yersinia infection
    122433033 (MAPK3)
   05133 Pertussis
    122433033 (MAPK3)
   05152 Tuberculosis
    122433033 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    122433033 (MAPK3)
   05140 Leishmaniasis
    122433033 (MAPK3)
   05142 Chagas disease
    122433033 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122433033 (MAPK3)
   05020 Prion disease
    122433033 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    122433033 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    122433033 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122433033 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    122433033 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    122433033 (MAPK3)
   04934 Cushing syndrome
    122433033 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    122433033 (MAPK3)
   01524 Platinum drug resistance
    122433033 (MAPK3)
   01522 Endocrine resistance
    122433033 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccad01001]
    122433033 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccad03036]
    122433033 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccad04147]
    122433033 (MAPK3)
Enzymes [BR:ccad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     122433033 (MAPK3)
Protein kinases [BR:ccad01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   122433033 (MAPK3)
Chromosome and associated proteins [BR:ccad03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     122433033 (MAPK3)
Exosome [BR:ccad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   122433033 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 122433033
NCBI-ProteinID: XP_043311382
LinkDB
Position
32:20010762..20017544
AA seq 380 aa
MAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGVLEAS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggctgcggctcaggggggcgggggcggggagccccggggaactgatggg
gtcggcccgggggtcccgggggaagtggagatagtaaaggggcagccgttcgacgtgggc
ccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct
tacgaccacgtgcgcaagactcgagtggccatcaagaaaatcagcccctttgagcatcag
acctactgccagcgcacattgcgagagattcagattctgctgcgcttccgccatgagaac
gtcatcggcatccgagacattctgcgggcacccaccctggaagccatgagggatgtctac
atcgtgcaggacctgatggagacagacctgtacaaattgctcaagagccagcagctgagc
aacgaccatgtctgctacttcctgtaccagatcctgcggggcctgaagtatatccactct
gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatctgtgattttggtcttgcccggattgctgatcccgagcacgaccacactggc
ttcctgacggaatacgtggccacacgctggtaccgggccccagagatcatgcttaactcc
aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctgggt
attctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaac
tacctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcctaagtcg
gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc
acagtggaagaagcactggctcacccctacctggagcagtactatgacccaacggatgag
ccagtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggaacga
ctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctggaggcctcc
taa

DBGET integrated database retrieval system