KEGG   Cervus canadensis (wapiti): 122433255
Entry
122433255         CDS       T07554                                 
Name
(RefSeq) integrin alpha-X-like
  KO
K06462  integrin alpha X
Organism
ccad  Cervus canadensis (wapiti)
Pathway
ccad04610  Complement and coagulation cascades
ccad04810  Regulation of actin cytoskeleton
ccad05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ccad00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122433255
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    122433255
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    122433255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ccad04515]
    122433255
   04090 CD molecules [BR:ccad04090]
    122433255
Cell adhesion molecules [BR:ccad04515]
 Integrins
  Integrin alpha subunits
   122433255
CD molecules [BR:ccad04090]
 Proteins
  122433255
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE
Other DBs
NCBI-GeneID: 122433255
NCBI-ProteinID: XP_043311928
LinkDB
Position
32:21202063..21221805
AA seq 1168 aa
MPTSDLLVMTGTQVFLFLLMAPVSSFCFNLDTEQPTTFRVDSPGFGHSVVQYAKWLVVGA
PQEVKAANQTGGLYRCDYSMRSCEAIPLQVPPEAVNMSLGLSMAATTNPFQLLACGPTVH
HACRENMHLTGICFLLASPFRQVQRIPAALQECPKQDQDIVFLIDGSGSISSWDFNKMLN
FVKAMMSQFQRPSSQFSLVQFSTKTTQHFTFKDFATSSDPLSLLNSVRQMRGWTFTASAI
RLVTDRLFSAAYGARKDASKILIVITDGEKTEKLDYKDVIPQAEAAGIIRYAIGVGSAFR
YTNTLQELIDIASTPSKEHVFQVENFDALRDIQKQLKEKIFAIEGTQTISSSSFELEMSQ
EGFSAVFMPDGPVLGAVGSFSWSGGAFLYPQNKNPTFINMSQEHVDMRDSYLGYSTELAL
WKGQQNLILGAPRHQHTGKVVLFTQESRQWKPKAEVTGSQIGSYFGASLCSVDVNGDSSS
DLVLIGAPHFYEQTQGGQVSVCPFPQGRAKWQCDAVLRGEPGHPWSRFGAALTALGDVNG
DRLADVAIGAPGEQENQGAVYLFHGTSELGISPSHSQRITGAQLSPSLQYFGQSLSGGQD
LTQDGLADLAVGAQGHALLLRTRPVLRMGVNIHITPAEITRSVYECQQLGTFPHDLGEAA
VCLHVSQSPKNQLVNLQSIVTFDLTLDPGRLSPRAIFQETKTRNLTRVRELGLKQHCEAV
RLLLPDCVEDSVTPIILRLNFSLVGKPISSLRNLQPMLAVDAQRYFTTSLPFEKNCGADH
VCQDDLSISFGVSDASLKTLIVGSNLELNLKVRVWNDGEDSYGTSVTFFYPPGLSYQRVT
GGQNHLQSRSLRLTCDSAPAGTQGTRSTRCSINHFIFREGAQITFTVSFHVAPTATLGDK
LLLAANVSSENNSPKTSKTAFQLELPVKYAVYTVISSHEQSTKYLNFSASQEEGSRAAQH
RYQVNNLGQRDLPVSIHISVPAELNQIAVWKDIVVLNPQNPSIQCSSERTAPTESDFLTH
LTKKPVLDCSIADCLRFRCDIPSFGIQEELDFILKGNLSFRWVSQTQQKKVLVVSVAEIT
FNRLVYSQLPGQETFLRAQTELVLEKYEVYNPIPLMVGSSVGGLLLLALITALLYKVGFF
KRQYKEMMEGANNQTVPENETGDPQVAQ
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgcccacgtctgaccttcttgtcatgaccgggacccaggtttttctcttcctgttgatg
gccccggtgtcctctttctgcttcaacttggacacggagcaaccgacaaccttccgtgtg
gacagccctgggtttggacacagtgtggtccagtatgccaaatggctggtggttggagcc
ccccaggaagtaaaggctgccaatcaaacaggcggcctctaccggtgcgactacagcatg
cgcagctgtgaggccatccccctgcaggtgcccccagaggctgtgaacatgtccctgggc
ctgtccatggcggccaccaccaacccctttcagctgctggcctgtggccccaccgtgcac
cacgcatgccgggagaacatgcacttgaccgggatctgctttctgctggcctccccgttc
cggcaggtccagaggatcccggcggccctgcaggagtgcccaaagcaggatcaggacatc
gtctttctgatcgacggctcaggcagcatctcctcctgggattttaacaaaatgttgaac
ttcgtgaaggccatgatgagccagttccagcgtcccagctcccagttctccctggtgcag
ttctccaccaagaccacgcaacacttcactttcaaagacttcgctaccagctcagaccca
ctaagcctcctgaattccgtccggcagatgcgagggtggacgttcacggcctcagccatc
cgattggtcacagatcgactgttcagtgccgcatacggggcccgaaaagatgcctccaaa
atcctcatcgtcatcaccgatggggagaaaacagaaaaactggattacaaggatgtcatt
ccccaagctgaggccgccggcatcatccgatatgcaattggggtgggatcagcatttcga
tacacaaataccttgcaagaattaatcgacattgcctccacaccctctaaagagcatgta
tttcaagtggagaacttcgatgctttgcgagacattcagaaacaactgaaagagaagatt
tttgccattgagggtacgcagacaataagcagtagttccttcgaattggagatgtctcag
gagggcttcagtgctgtgttcatgcctgatgggccagttctgggggctgtggggagcttc
agctggtctggaggtgccttcttgtacccccaaaataagaaccccaccttcatcaacatg
tcccaggagcacgtggacatgagggactcttacctgggttactccacagagctggccctt
tggaaggggcaacagaacctgatcctgggggccccccgccatcagcacaccgggaaggtg
gtcctcttcacccaggagtccaggcaatggaagccgaaggctgaagtcacagggagccag
atcggctcctacttcggggcctccctctgctccgtggatgtgaatggagatagtagctct
gatctggtcctcatcggggctccccatttctacgagcagacccaggggggccaggtgtct
gtgtgcccctttccccaggggagagctaagtggcagtgtgatgctgtcctgcgaggggag
cccggccacccctggagccgctttggggcagccctgacagcgctgggggatgtgaatggg
gacaggctggcggatgtggccattggggccccgggagagcaggagaaccagggtgctgtc
tacctgttccacggaacctcagaactgggcatcagcccctcccacagccagcggatcaca
ggcgcccagctctcccccagcctccagtatttcgggcagtcgctgagcgggggtcaggac
ctcacccaggatggactggcagacttggccgtgggggcccaggggcacgcgttgctgctc
aggaccagacctgtgctcaggatgggggtgaacattcacatcacacccgcagagatcacc
aggtctgtgtatgagtgtcagcagctggggacctttccccatgatctgggcgaggccgct
gtctgcctccatgtttcccaaagtcccaagaaccagctggttaacctccaaagcattgtg
acctttgacctaacccttgaccctggccgcctgagtcctcgtgccatcttccaagagacg
aagactcggaatctgacccgtgttcgagagctggggctgaagcagcactgcgaggctgtg
aggttgctccttccggactgtgtggaggactcggtgacccccatcatattgcgtctcaac
ttctccctggtgggcaagcccatctctagcctaagaaacctccagcctatgctggcagtg
gacgcccagagatacttcacgacctctctcccctttgagaagaattgtggtgcggatcat
gtctgccaggatgacctcagcatctcctttggggtctcagatgctagcttgaagaccctg
atcgtggggagtaacctggagctgaacttgaaagtgagagtgtggaatgatggcgaggac
tcctatggaacctcagtcaccttcttctaccctccagggctgtcttaccaacgtgtgacc
gggggccagaaccatctgcagtctcgttccctgcgtctgacctgtgacagcgcccctgct
gggacccagggcacccgaagcacccgctgtagcatcaaccacttcatcttccgtgagggc
gcccagatcaccttcacggtcagctttcacgtcgcccccacggccaccctgggagacaag
ctgcttcttgccgccaatgtgagcagtgagaataacagccccaagacaagcaagactgcc
ttccagctggagctgcccgtgaagtatgccgtctacaccgtgatcagcagccacgaacaa
tccaccaagtacctcaacttctcggcctcacaggaggagggcagcagggcggcccagcac
agataccaggtgaacaacctggggcagagggacctgcctgtcagtatccacatctcagtg
cccgcggagctgaaccagatagccgtgtggaaggacatagtggtcctcaacccccagaac
ccctccattcagtgctcttcagagagaacagcgcccacagagtctgacttcctgacccac
ttgacgaagaagcctgtcctggactgctccatcgctgactgcctgaggttccgctgtgac
atcccctcctttggcatccaggaggaacttgacttcatcctgaagggcaacctcagcttc
cgctgggtcagccagacacagcagaagaaggtgctggttgtgagcgtggctgaaatcacc
ttcaacagactcgtgtattctcagcttccaggacaggagacatttttgagagctcagacg
gagctggtgctggagaagtatgaagtctacaaccccatccccctcatggtgggtagctct
gtgggaggactgctgctcctggccctcatcacagctttactgtataaggttggtttcttc
aaacgtcagtacaaggaaatgatggaaggagcaaacaatcagactgtcccagaaaatgag
acaggagacccccaagttgcccaataa

DBGET integrated database retrieval system