Cervus canadensis (wapiti): 122433570 Help Entry 122433570         CDS       T07554                                  Symbol ELOB Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism ccad  Cervus canadensis (wapiti) Pathway ccad04066   HIF-1 signaling pathway ccad04120   Ubiquitin mediated proteolysis ccad05170   Human immunodeficiency virus 1 infection ccad05200   Pathways in cancer ccad05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:ccad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     122433570 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     122433570 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122433570 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     122433570 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122433570 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccad04121]     122433570 (ELOB)    03400 DNA repair and recombination proteins [BR:ccad03400]     122433570 (ELOB) Ubiquitin system [BR:ccad04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      122433570 (ELOB)    Cul5 complex      122433570 (ELOB) DNA repair and recombination proteins [BR:ccad03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      122433570 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  122433570 NCBI-ProteinID:  XP_043312562 LinkDB All DBs Position 32:complement(37557539..37561674) Genome browser AA seq 150 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRAGENCHSAVRWFFPMTPSCGIRCGDCTLGGSTSDEAFEAL RIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagcaccgtgttcgagctgaagcgcatcgtcgagggtatcctcaagcggccgccggat gagcagcggctgtacaaggacgaccagcttctggacgacggcaagacgttgggcgagtgt ggcttcaccagtcagacagcacggcctcaggcccctgccactgtggggctagccttcagg gcaggtgaaaactgtcacagtgcagtgaggtggtttttccccatgacccccagctgtggc atacgttgtggtgactgcaccttgggtggcagcacctcagatgaggcgttcgaggccctg cgcatcgagcccttttccagcccacctgagctgccggatgtgatgaagccacaggactca ggaagcagcgccaacgaacaggctgtgcagtga

DBGET integrated database retrieval system