Cervus canadensis (wapiti): 122433957 Help Entry 122433957         CDS       T07554                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism ccad  Cervus canadensis (wapiti) Pathway ccad04613   Neutrophil extracellular trap formation ccad05034   Alcoholism ccad05203   Viral carcinogenesis ccad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122433957  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     122433957   09163 Immune disease    05322 Systemic lupus erythematosus     122433957   09165 Substance dependence    05034 Alcoholism     122433957  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccad03036]     122433957   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccad04147]     122433957 Chromosome and associated proteins [BR:ccad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122433957 Exosome [BR:ccad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122433957 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  122433957 NCBI-ProteinID:  XP_043312999 LinkDB All DBs Position 2:17761559..17762230 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKRGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccggcaaaatccgctcccgcgcccaaaaggggctccaagaaagccgtcact aaagcccagaaaaaggacggcaagaagcgcaagcgcagccgcaaggagagctattccatc tacgtgtacaaggtgctgaagcaggtgcacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgtttgtcaacgacatcttcgagcgcatcgcgggcgaagcgtcgcgc ttggcccattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggcgaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system