Cervus canadensis (wapiti): 122435924 Help Entry 122435924         CDS       T07554                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ccad  Cervus canadensis (wapiti) Pathway ccad01521   EGFR tyrosine kinase inhibitor resistance ccad01522   Endocrine resistance ccad04010   MAPK signaling pathway ccad04012   ErbB signaling pathway ccad04014   Ras signaling pathway ccad04015   Rap1 signaling pathway ccad04062   Chemokine signaling pathway ccad04068   FoxO signaling pathway ccad04071   Sphingolipid signaling pathway ccad04072   Phospholipase D signaling pathway ccad04137   Mitophagy - animal ccad04140   Autophagy - animal ccad04150   mTOR signaling pathway ccad04151   PI3K-Akt signaling pathway ccad04210   Apoptosis ccad04211   Longevity regulating pathway ccad04213   Longevity regulating pathway - multiple species ccad04218   Cellular senescence ccad04360   Axon guidance ccad04370   VEGF signaling pathway ccad04371   Apelin signaling pathway ccad04519   Cadherin signaling ccad04540   Gap junction ccad04550   Signaling pathways regulating pluripotency of stem cells ccad04625   C-type lectin receptor signaling pathway ccad04650   Natural killer cell mediated cytotoxicity ccad04660   T cell receptor signaling pathway ccad04662   B cell receptor signaling pathway ccad04664   Fc epsilon RI signaling pathway ccad04714   Thermogenesis ccad04720   Long-term potentiation ccad04722   Neurotrophin signaling pathway ccad04725   Cholinergic synapse ccad04726   Serotonergic synapse ccad04730   Long-term depression ccad04810   Regulation of actin cytoskeleton ccad04910   Insulin signaling pathway ccad04912   GnRH signaling pathway ccad04915   Estrogen signaling pathway ccad04916   Melanogenesis ccad04917   Prolactin signaling pathway ccad04919   Thyroid hormone signaling pathway ccad04921   Oxytocin signaling pathway ccad04926   Relaxin signaling pathway ccad04929   GnRH secretion ccad04933   AGE-RAGE signaling pathway in diabetic complications ccad04935   Growth hormone synthesis, secretion and action ccad05010   Alzheimer disease ccad05022   Pathways of neurodegeneration - multiple diseases ccad05034   Alcoholism ccad05160   Hepatitis C ccad05161   Hepatitis B ccad05163   Human cytomegalovirus infection ccad05165   Human papillomavirus infection ccad05166   Human T-cell leukemia virus 1 infection ccad05167   Kaposi sarcoma-associated herpesvirus infection ccad05170   Human immunodeficiency virus 1 infection ccad05200   Pathways in cancer ccad05203   Viral carcinogenesis ccad05205   Proteoglycans in cancer ccad05206   MicroRNAs in cancer ccad05207   Chemical carcinogenesis - receptor activation ccad05208   Chemical carcinogenesis - reactive oxygen species ccad05210   Colorectal cancer ccad05211   Renal cell carcinoma ccad05213   Endometrial cancer ccad05214   Glioma ccad05215   Prostate cancer ccad05216   Thyroid cancer ccad05218   Melanoma ccad05219   Bladder cancer ccad05220   Chronic myeloid leukemia ccad05221   Acute myeloid leukemia ccad05223   Non-small cell lung cancer ccad05224   Breast cancer ccad05225   Hepatocellular carcinoma ccad05226   Gastric cancer ccad05230   Central carbon metabolism in cancer ccad05231   Choline metabolism in cancer ccad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122435924 (NRAS)    04012 ErbB signaling pathway     122435924 (NRAS)    04014 Ras signaling pathway     122435924 (NRAS)    04015 Rap1 signaling pathway     122435924 (NRAS)    04370 VEGF signaling pathway     122435924 (NRAS)    04371 Apelin signaling pathway     122435924 (NRAS)    04068 FoxO signaling pathway     122435924 (NRAS)    04072 Phospholipase D signaling pathway     122435924 (NRAS)    04071 Sphingolipid signaling pathway     122435924 (NRAS)    04151 PI3K-Akt signaling pathway     122435924 (NRAS)    04150 mTOR signaling pathway     122435924 (NRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     122435924 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122435924 (NRAS)    04137 Mitophagy - animal     122435924 (NRAS)   09143 Cell growth and death    04210 Apoptosis     122435924 (NRAS)    04218 Cellular senescence     122435924 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     122435924 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     122435924 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122435924 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122435924 (NRAS)    04650 Natural killer cell mediated cytotoxicity     122435924 (NRAS)    04660 T cell receptor signaling pathway     122435924 (NRAS)    04662 B cell receptor signaling pathway     122435924 (NRAS)    04664 Fc epsilon RI signaling pathway     122435924 (NRAS)    04062 Chemokine signaling pathway     122435924 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     122435924 (NRAS)    04929 GnRH secretion     122435924 (NRAS)    04912 GnRH signaling pathway     122435924 (NRAS)    04915 Estrogen signaling pathway     122435924 (NRAS)    04917 Prolactin signaling pathway     122435924 (NRAS)    04921 Oxytocin signaling pathway     122435924 (NRAS)    04926 Relaxin signaling pathway     122435924 (NRAS)    04935 Growth hormone synthesis, secretion and action     122435924 (NRAS)    04919 Thyroid hormone signaling pathway     122435924 (NRAS)    04916 Melanogenesis     122435924 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     122435924 (NRAS)    04726 Serotonergic synapse     122435924 (NRAS)    04720 Long-term potentiation     122435924 (NRAS)    04730 Long-term depression     122435924 (NRAS)    04722 Neurotrophin signaling pathway     122435924 (NRAS)   09158 Development and regeneration    04360 Axon guidance     122435924 (NRAS)   09149 Aging    04211 Longevity regulating pathway     122435924 (NRAS)    04213 Longevity regulating pathway - multiple species     122435924 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     122435924 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122435924 (NRAS)    05206 MicroRNAs in cancer     122435924 (NRAS)    05205 Proteoglycans in cancer     122435924 (NRAS)    05207 Chemical carcinogenesis - receptor activation     122435924 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     122435924 (NRAS)    05203 Viral carcinogenesis     122435924 (NRAS)    05230 Central carbon metabolism in cancer     122435924 (NRAS)    05231 Choline metabolism in cancer     122435924 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122435924 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     122435924 (NRAS)    05225 Hepatocellular carcinoma     122435924 (NRAS)    05226 Gastric cancer     122435924 (NRAS)    05214 Glioma     122435924 (NRAS)    05216 Thyroid cancer     122435924 (NRAS)    05221 Acute myeloid leukemia     122435924 (NRAS)    05220 Chronic myeloid leukemia     122435924 (NRAS)    05218 Melanoma     122435924 (NRAS)    05211 Renal cell carcinoma     122435924 (NRAS)    05219 Bladder cancer     122435924 (NRAS)    05215 Prostate cancer     122435924 (NRAS)    05213 Endometrial cancer     122435924 (NRAS)    05224 Breast cancer     122435924 (NRAS)    05223 Non-small cell lung cancer     122435924 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122435924 (NRAS)    05170 Human immunodeficiency virus 1 infection     122435924 (NRAS)    05161 Hepatitis B     122435924 (NRAS)    05160 Hepatitis C     122435924 (NRAS)    05163 Human cytomegalovirus infection     122435924 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     122435924 (NRAS)    05165 Human papillomavirus infection     122435924 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     122435924 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     122435924 (NRAS)   09165 Substance dependence    05034 Alcoholism     122435924 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122435924 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     122435924 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     122435924 (NRAS)    01522 Endocrine resistance     122435924 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccad04131]     122435924 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccad04147]     122435924 (NRAS)    04031 GTP-binding proteins [BR:ccad04031]     122435924 (NRAS) Membrane trafficking [BR:ccad04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     122435924 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     122435924 (NRAS) Exosome [BR:ccad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122435924 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    122435924 (NRAS)   Exosomal proteins of breast cancer cells    122435924 (NRAS)   Exosomal proteins of colorectal cancer cells    122435924 (NRAS) GTP-binding proteins [BR:ccad04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122435924 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  122435924 NCBI-ProteinID:  XP_043315966 LinkDB All DBs Position 2:27562714..27572624 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgtcgggaaaagtgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcgtac cgaaaacaggtggttatagatggtgagacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccagtacatgaggacaggcgaaggcttcctttgt gtgtttgccatcaataatagcaaatcatttgcagacattaacctctacagggaacagatt aagcgcgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaaaagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactgaacagcagtgatgatggcactcaaggt tgtatggggctgccgtgtgtggtaatgtaa

DBGET integrated database retrieval system