Cervus canadensis (wapiti): 122438889 Help Entry 122438889         CDS       T07554                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism ccad  Cervus canadensis (wapiti) Pathway ccad04072   Phospholipase D signaling pathway ccad04140   Autophagy - animal ccad04150   mTOR signaling pathway ccad04151   PI3K-Akt signaling pathway ccad04152   AMPK signaling pathway ccad04211   Longevity regulating pathway ccad04218   Cellular senescence ccad04714   Thermogenesis ccad04910   Insulin signaling pathway ccad04919   Thyroid hormone signaling pathway ccad05163   Human cytomegalovirus infection ccad05165   Human papillomavirus infection ccad05168   Herpes simplex virus 1 infection ccad05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     122438889 (RHEB)    04151 PI3K-Akt signaling pathway     122438889 (RHEB)    04152 AMPK signaling pathway     122438889 (RHEB)    04150 mTOR signaling pathway     122438889 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122438889 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     122438889 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     122438889 (RHEB)    04919 Thyroid hormone signaling pathway     122438889 (RHEB)   09149 Aging    04211 Longevity regulating pathway     122438889 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     122438889 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     122438889 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     122438889 (RHEB)    05163 Human cytomegalovirus infection     122438889 (RHEB)    05165 Human papillomavirus infection     122438889 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ccad04031]     122438889 (RHEB) GTP-binding proteins [BR:ccad04031]  Small (monomeric) G-proteins   Ras Family    Rheb     122438889 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  122438889 NCBI-ProteinID:  XP_043320123 LinkDB All DBs Position 3:complement(113343735..113396118) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcgttgacgattcagtttgttgaaggccaatttgttgactcctacgatccaaccatagaa aatactttcacaaaattgatcacagtcaatggacaggagtatcaccttcaacttgtagac acggctgggcaggatgaatattccatctttcctcagacatactccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgatcaaagttatccat ggcaaattgttggatatggtggggaaagtacaaatacctattatgttggttgggaataag aaagacctacatatggaaagggtgatcagttatgaagaagggaaggcgttagcagagtct tggaatgcagcatttttggaatcttctgctaaagaaaatcagactgctgttgacgttttt agaaggataattttggaggcagaaaaaatcgatggggccgcttcacaaggaaagtcttcc tgctcggtgatgtga

DBGET integrated database retrieval system