Cervus canadensis (wapiti): 122440155 Help Entry 122440155         CDS       T07554                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism ccad  Cervus canadensis (wapiti) Pathway ccad04060   Cytokine-cytokine receptor interaction ccad04630   JAK-STAT signaling pathway ccad04640   Hematopoietic cell lineage ccad04657   IL-17 signaling pathway ccad04658   Th1 and Th2 cell differentiation ccad04660   T cell receptor signaling pathway ccad04664   Fc epsilon RI signaling pathway ccad04672   Intestinal immune network for IgA production ccad05200   Pathways in cancer ccad05310   Asthma ccad05320   Autoimmune thyroid disease ccad05321   Inflammatory bowel disease ccad05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122440155 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122440155 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     122440155 (IL5)    04660 T cell receptor signaling pathway     122440155 (IL5)    04658 Th1 and Th2 cell differentiation     122440155 (IL5)    04657 IL-17 signaling pathway     122440155 (IL5)    04664 Fc epsilon RI signaling pathway     122440155 (IL5)    04672 Intestinal immune network for IgA production     122440155 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122440155 (IL5)   09163 Immune disease    05310 Asthma     122440155 (IL5)    05320 Autoimmune thyroid disease     122440155 (IL5)    05321 Inflammatory bowel disease     122440155 (IL5)    05330 Allograft rejection     122440155 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122440155 (IL5)    00536 Glycosaminoglycan binding proteins [BR:ccad00536]     122440155 (IL5) Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Interleukins    122440155 (IL5) Glycosaminoglycan binding proteins [BR:ccad00536]  Heparan sulfate / Heparin   Cytokines    122440155 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  122440155 NCBI-ProteinID:  XP_043321953 LinkDB All DBs Position 4:complement(85348311..85350739) Genome browser AA seq 134 aa AA seqDB search MRMLLHLTLVALGAAHVCVFAVESTLSRLVAETLTLLSTHRTLLIGDGNLMIPTPEHTNH QLCIEEVFQGIDTLKNQTAQGDGVKKIFKNLSLIKEHIDSQKKKCGGERWRVKQFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcttctgcatttgactttggttgctcttggagctgcccatgtttgtgtcttt gctgtagaaagtaccctgagtagactggtggcagagaccttgacattgctctccactcat cgaactctgctgataggtgatgggaacttgatgattcctactcctgagcatacaaatcac caactatgcattgaagaagtctttcagggaatagacacattgaagaatcaaactgcacaa ggggatggcgtgaaaaaaatattcaaaaacttgtctttaataaaagaacacatagacagc caaaaaaagaagtgtggaggagaaagatggagagtcaaacaattcctagactacctgcaa gtttttcttggtgtgataaacacggagtggacaatggaaagttga

DBGET integrated database retrieval system