Cervus canadensis (wapiti): 122440668 Help Entry 122440668         CDS       T07554                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism ccad  Cervus canadensis (wapiti) Pathway ccad04140   Autophagy - animal ccad04144   Endocytosis ccad04152   AMPK signaling pathway ccad04530   Tight junction ccad04972   Pancreatic secretion ccad05014   Amyotrophic lateral sclerosis ccad05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     122440668 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122440668 (RAB8A)    04140 Autophagy - animal     122440668 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     122440668 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     122440668 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122440668 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     122440668 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccad04131]     122440668 (RAB8A)    03036 Chromosome and associated proteins [BR:ccad03036]     122440668 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccad04147]     122440668 (RAB8A)    04031 GTP-binding proteins [BR:ccad04031]     122440668 (RAB8A) Membrane trafficking [BR:ccad04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     122440668 (RAB8A)  Autophagy   Other autophagy associated proteins     122440668 (RAB8A) Chromosome and associated proteins [BR:ccad03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     122440668 (RAB8A) Exosome [BR:ccad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122440668 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    122440668 (RAB8A)   Exosomal proteins of colorectal cancer cells    122440668 (RAB8A) GTP-binding proteins [BR:ccad04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     122440668 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 Septin DUF3963 AAA_7 DUF6974 Motif Other DBs NCBI-GeneID:  122440668 NCBI-ProteinID:  XP_043323127 LinkDB All DBs Position 4:102069971..102091036 Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFYTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacggcctactacaggggt gcaatgggcatcatgctggtctacgacatcaccaacgagaagtcctttgataacatccgg aactggattcggaacattgaagagcacgcctctgcagacgtcgaaaagatgatacttggg aacaagtgcgacgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc ctggactatggaatcaagttcatggagacaagcgcaaaggccaacatcaacgtggagaac gcattttacactctcgccagagacatcaaagcaaaaatggataaaaaattggaaggcaac agcccccaggggagcaaccaaggagtcaaaatcaccccggaccagcagaagaggagcagc ttcttccgatgtgttcttctgtga

DBGET integrated database retrieval system