Cervus canadensis (wapiti): 122441342 Help Entry 122441342         CDS       T07554                                  Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ccad  Cervus canadensis (wapiti) Pathway ccad01521   EGFR tyrosine kinase inhibitor resistance ccad01524   Platinum drug resistance ccad04014   Ras signaling pathway ccad04064   NF-kappa B signaling pathway ccad04115   p53 signaling pathway ccad04137   Mitophagy - animal ccad04140   Autophagy - animal ccad04151   PI3K-Akt signaling pathway ccad04210   Apoptosis ccad04215   Apoptosis - multiple species ccad04621   NOD-like receptor signaling pathway ccad04630   JAK-STAT signaling pathway ccad05012   Parkinson disease ccad05014   Amyotrophic lateral sclerosis ccad05022   Pathways of neurodegeneration - multiple diseases ccad05145   Toxoplasmosis ccad05162   Measles ccad05166   Human T-cell leukemia virus 1 infection ccad05168   Herpes simplex virus 1 infection ccad05170   Human immunodeficiency virus 1 infection ccad05200   Pathways in cancer ccad05202   Transcriptional misregulation in cancer ccad05212   Pancreatic cancer ccad05220   Chronic myeloid leukemia ccad05222   Small cell lung cancer ccad05225   Hepatocellular carcinoma ccad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122441342    04630 JAK-STAT signaling pathway     122441342    04064 NF-kappa B signaling pathway     122441342    04151 PI3K-Akt signaling pathway     122441342  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122441342    04137 Mitophagy - animal     122441342   09143 Cell growth and death    04210 Apoptosis     122441342    04215 Apoptosis - multiple species     122441342    04115 p53 signaling pathway     122441342  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     122441342  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122441342    05202 Transcriptional misregulation in cancer     122441342   09162 Cancer: specific types    05212 Pancreatic cancer     122441342    05225 Hepatocellular carcinoma     122441342    05220 Chronic myeloid leukemia     122441342    05222 Small cell lung cancer     122441342   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122441342    05170 Human immunodeficiency virus 1 infection     122441342    05162 Measles     122441342    05168 Herpes simplex virus 1 infection     122441342   09174 Infectious disease: parasitic    05145 Toxoplasmosis     122441342   09164 Neurodegenerative disease    05012 Parkinson disease     122441342    05014 Amyotrophic lateral sclerosis     122441342    05022 Pathways of neurodegeneration - multiple diseases     122441342   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122441342   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     122441342    01524 Platinum drug resistance     122441342  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccad01009]     122441342   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccad03036]     122441342   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ccad02000]     122441342 Protein phosphatases and associated proteins [BR:ccad01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      122441342 Chromosome and associated proteins [BR:ccad03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     122441342 Transporters [BR:ccad02000]  Other transporters   Pores ion channels [TC:1]    122441342 SSDB OrthologParalogGFIT Motif Pfam:  BH4 Bcl-2 tRNA_lig_CPD DLT1_C Motif Other DBs NCBI-GeneID:  122441342 NCBI-ProteinID:  XP_043323689 LinkDB All DBs Position 5:complement(9983618..9984316) Genome browser AA seq 173 aa AA seqDB search MSQSNRELVVDFLSYKLSKKGYSWSQFSDMEENRAETPEGTESDMETPNAINGNPSWHLA DSPVVNGATGHSRSLDARKLIPMTTVEQALREASNEFELRYQQTFSNLMSQLHITPGTTY QSFEQNGNWDTFVELYENNTATKSQKGQERFIHWSLMDMTVAGMVLLGLFFNS NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgagaactagtggttgactttctctcttacaagctttccaagaaa ggctacagctggagtcagtttagtgatatggaagagaacagagctgaaaccccagaaggg acagaatcagatatggaaacccccaatgccatcaatggcaacccatcctggcacctggca gatagccctgtggtgaatggagccactggccacagcagaagcttggatgcccggaaactg atccccatgacaacagtagagcaagccctgagggaggcaagcaatgagtttgaactgaga taccaacagacattcagcaacctgatgtcccagctccacatcaccccagggacaacatat cagagctttgaacaaaatggcaactgggacacttttgtggaactctatgaaaacaataca gcaaccaagagccaaaagggccaagagcgcttcatccactggtccctgatggacatgact gtggctggtatggttctgctgggcttgttcttcaactcatag

DBGET integrated database retrieval system