Cervus canadensis (wapiti): 122441856 Help Entry 122441856         CDS       T07554                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ccad  Cervus canadensis (wapiti) Pathway ccad04010   MAPK signaling pathway ccad04020   Calcium signaling pathway ccad04022   cGMP-PKG signaling pathway ccad04114   Oocyte meiosis ccad04218   Cellular senescence ccad04310   Wnt signaling pathway ccad04360   Axon guidance ccad04370   VEGF signaling pathway ccad04380   Osteoclast differentiation ccad04625   C-type lectin receptor signaling pathway ccad04650   Natural killer cell mediated cytotoxicity ccad04658   Th1 and Th2 cell differentiation ccad04659   Th17 cell differentiation ccad04660   T cell receptor signaling pathway ccad04662   B cell receptor signaling pathway ccad04720   Long-term potentiation ccad04724   Glutamatergic synapse ccad04921   Oxytocin signaling pathway ccad04922   Glucagon signaling pathway ccad04924   Renin secretion ccad05010   Alzheimer disease ccad05014   Amyotrophic lateral sclerosis ccad05020   Prion disease ccad05022   Pathways of neurodegeneration - multiple diseases ccad05031   Amphetamine addiction ccad05152   Tuberculosis ccad05163   Human cytomegalovirus infection ccad05166   Human T-cell leukemia virus 1 infection ccad05167   Kaposi sarcoma-associated herpesvirus infection ccad05170   Human immunodeficiency virus 1 infection ccad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122441856 (PPP3R1)    04310 Wnt signaling pathway     122441856 (PPP3R1)    04370 VEGF signaling pathway     122441856 (PPP3R1)    04020 Calcium signaling pathway     122441856 (PPP3R1)    04022 cGMP-PKG signaling pathway     122441856 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     122441856 (PPP3R1)    04218 Cellular senescence     122441856 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122441856 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     122441856 (PPP3R1)    04660 T cell receptor signaling pathway     122441856 (PPP3R1)    04658 Th1 and Th2 cell differentiation     122441856 (PPP3R1)    04659 Th17 cell differentiation     122441856 (PPP3R1)    04662 B cell receptor signaling pathway     122441856 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     122441856 (PPP3R1)    04921 Oxytocin signaling pathway     122441856 (PPP3R1)    04924 Renin secretion     122441856 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     122441856 (PPP3R1)    04720 Long-term potentiation     122441856 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     122441856 (PPP3R1)    04380 Osteoclast differentiation     122441856 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122441856 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122441856 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     122441856 (PPP3R1)    05163 Human cytomegalovirus infection     122441856 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     122441856 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     122441856 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     122441856 (PPP3R1)    05014 Amyotrophic lateral sclerosis     122441856 (PPP3R1)    05020 Prion disease     122441856 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     122441856 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     122441856 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122441856 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccad01009]     122441856 (PPP3R1) Protein phosphatases and associated proteins [BR:ccad01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      122441856 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  122441856 NCBI-ProteinID:  XP_043324859 LinkDB All DBs Position 5:complement(62988304..63047630) Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagatttaagaagctcgatttggacaattctggttctttgagtgtg gaagagttcatgtctctacctgagttacaacagaatcccttagtacagcgagtaatagat atattcgacacagatgggaatggagaagtagactttaaagaattcattgaaggggtctct cagttcagcgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac atggataaagacggctatatttccaatggggaactcttccaggtgctaaagatgatggtg gggaacaatctgaaagatacacagttacagcaaatcgtagacaaaaccataataaatgca gataaggatggggatggaagaatatcctttgaagaattctgtgctgttgtaggcggccta gatatccacaaaaagatggtggtagacgtgtga

DBGET integrated database retrieval system