Cervus canadensis (wapiti): 122443461 Help Entry 122443461         CDS       T07554                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism ccad  Cervus canadensis (wapiti) Pathway ccad04014   Ras signaling pathway ccad04072   Phospholipase D signaling pathway ccad04144   Endocytosis ccad04517   IgSF CAM signaling ccad04666   Fc gamma R-mediated phagosome formation ccad05132   Salmonella infection ccad05135   Yersinia infection Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122443461 (ARF6)    04072 Phospholipase D signaling pathway     122443461 (ARF6)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     122443461 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122443461 (ARF6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     122443461 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122443461 (ARF6)    05135 Yersinia infection     122443461 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccad04131]     122443461 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccad04147]     122443461 (ARF6)    04031 GTP-binding proteins [BR:ccad04031]     122443461 (ARF6) Membrane trafficking [BR:ccad04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     122443461 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     122443461 (ARF6) Exosome [BR:ccad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122443461 (ARF6)   Exosomal proteins of colorectal cancer cells    122443461 (ARF6) GTP-binding proteins [BR:ccad04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     122443461 (ARF6) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  122443461 NCBI-ProteinID:  XP_043327557 LinkDB All DBs Position 6:39520267..39524337 Genome browser AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctatctaagatcttcgggaacaaggaaatgcggatcctcatgttgggc ctggacgcagccggcaagacaaccatcctgtacaagttgaagctgggccagtcggtgacc accatccccactgtgggtttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtatgggatgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg acccagggtctcatcttcgtagtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc gccaacaagcaggacctccccgatgccatgaaaccccacgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctcgggggac ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system