Cervus canadensis (wapiti): 122444805 Help Entry 122444805         CDS       T07554                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism ccad  Cervus canadensis (wapiti) Pathway ccad04024   cAMP signaling pathway ccad04080   Neuroactive ligand-receptor interaction ccad04081   Hormone signaling ccad04935   Growth hormone synthesis, secretion and action ccad04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     122444805 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     122444805 (SST)    04081 Hormone signaling     122444805 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     122444805 (SST)   09154 Digestive system    04971 Gastric acid secretion     122444805 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122444805 (SST) Cytokines and neuropeptides [BR:ccad04052]  Neuropeptides   GPCR binding    122444805 (SST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  122444805 NCBI-ProteinID:  XP_043329382 LinkDB All DBs Position 7:55544077..55545561 Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcttgccgcctccagtgcgcgctggccgccctctccatcgtcctggctcttggc ggcgtcaccggcgcgccctcggatccccgactccgtcagtttctgcagaaatccctggct gctgccgctggcaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaacgatgccctggagcctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggagctgcagagatctgctaactcaaacccggccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttaa

DBGET integrated database retrieval system