Cervus canadensis (wapiti): 122445056 Help Entry 122445056         CDS       T07554                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism ccad  Cervus canadensis (wapiti) Pathway ccad04015   Rap1 signaling pathway ccad04810   Regulation of actin cytoskeleton ccad05014   Amyotrophic lateral sclerosis ccad05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     122445056 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     122445056 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122445056 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122445056 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccad04131]     122445056 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccad04812]     122445056 (PFN2)    04147 Exosome [BR:ccad04147]     122445056 (PFN2) Membrane trafficking [BR:ccad04131]  Others   Actin-binding proteins    Others     122445056 (PFN2) Cytoskeleton proteins [BR:ccad04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      122445056 (PFN2) Exosome [BR:ccad04147]  Exosomal proteins   Proteins found in most exosomes    122445056 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  122445056 NCBI-ProteinID:  XP_043329977 LinkDB All DBs Position 7:90833771..90839849 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPGEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccaggagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaatggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtg gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgccgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system