Cervus canadensis (wapiti): 122445398 Help Entry 122445398         CDS       T07554                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism ccad  Cervus canadensis (wapiti) Brite KEGG Orthology (KO) [BR:ccad00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ccad01002]     122445398 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccad04147]     122445398 (CSTB) Peptidases and inhibitors [BR:ccad01002]  Peptidase inhibitors   Family I25: cystatin family    122445398 (CSTB) Exosome [BR:ccad04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    122445398 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  122445398 NCBI-ProteinID:  XP_043330457 LinkDB All DBs Position 7:complement(21318211..21321673) Genome browser AA seq 98 aa AA seqDB search MMCGAPSATQPATAETQAIADKVKSQLEEKENKKFPVFKALEFKSQLVAGKNYFIKVQVD EDDFMHIRVFESLPHEGKPVALTSYQTNKGRHDELTYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggagcgccttccgccacgcagccggccacggccgagacccaggctatcgcc gacaaggtgaagtcccagctggaggagaaggagaacaagaagttcccagtgttcaaggct ctggagttcaaaagccagttggttgctgggaagaactacttcatcaaggttcaagtggac gaggatgacttcatgcacatccgagtgtttgaaagcctcccgcacgagggcaagcccgtg gccttgaccagctaccagaccaacaaaggcaggcatgacgagctgacgtatttctag

DBGET integrated database retrieval system