KEGG   Cervus canadensis (wapiti): 122448285
Entry
122448285         CDS       T07554                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
ccad  Cervus canadensis (wapiti)
Pathway
ccad04014  Ras signaling pathway
ccad04015  Rap1 signaling pathway
ccad04020  Calcium signaling pathway
ccad04022  cGMP-PKG signaling pathway
ccad04024  cAMP signaling pathway
ccad04070  Phosphatidylinositol signaling system
ccad04114  Oocyte meiosis
ccad04218  Cellular senescence
ccad04261  Adrenergic signaling in cardiomyocytes
ccad04270  Vascular smooth muscle contraction
ccad04371  Apelin signaling pathway
ccad04625  C-type lectin receptor signaling pathway
ccad04713  Circadian entrainment
ccad04720  Long-term potentiation
ccad04722  Neurotrophin signaling pathway
ccad04728  Dopaminergic synapse
ccad04740  Olfactory transduction
ccad04744  Phototransduction
ccad04750  Inflammatory mediator regulation of TRP channels
ccad04910  Insulin signaling pathway
ccad04912  GnRH signaling pathway
ccad04915  Estrogen signaling pathway
ccad04916  Melanogenesis
ccad04921  Oxytocin signaling pathway
ccad04922  Glucagon signaling pathway
ccad04924  Renin secretion
ccad04925  Aldosterone synthesis and secretion
ccad04970  Salivary secretion
ccad04971  Gastric acid secretion
ccad05010  Alzheimer disease
ccad05012  Parkinson disease
ccad05022  Pathways of neurodegeneration - multiple diseases
ccad05031  Amphetamine addiction
ccad05034  Alcoholism
ccad05133  Pertussis
ccad05152  Tuberculosis
ccad05163  Human cytomegalovirus infection
ccad05167  Kaposi sarcoma-associated herpesvirus infection
ccad05170  Human immunodeficiency virus 1 infection
ccad05200  Pathways in cancer
ccad05214  Glioma
ccad05417  Lipid and atherosclerosis
ccad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    122448285
   04015 Rap1 signaling pathway
    122448285
   04371 Apelin signaling pathway
    122448285
   04020 Calcium signaling pathway
    122448285
   04070 Phosphatidylinositol signaling system
    122448285
   04024 cAMP signaling pathway
    122448285
   04022 cGMP-PKG signaling pathway
    122448285
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    122448285
   04218 Cellular senescence
    122448285
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    122448285
  09152 Endocrine system
   04910 Insulin signaling pathway
    122448285
   04922 Glucagon signaling pathway
    122448285
   04912 GnRH signaling pathway
    122448285
   04915 Estrogen signaling pathway
    122448285
   04921 Oxytocin signaling pathway
    122448285
   04916 Melanogenesis
    122448285
   04924 Renin secretion
    122448285
   04925 Aldosterone synthesis and secretion
    122448285
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    122448285
   04270 Vascular smooth muscle contraction
    122448285
  09154 Digestive system
   04970 Salivary secretion
    122448285
   04971 Gastric acid secretion
    122448285
  09156 Nervous system
   04728 Dopaminergic synapse
    122448285
   04720 Long-term potentiation
    122448285
   04722 Neurotrophin signaling pathway
    122448285
  09157 Sensory system
   04744 Phototransduction
    122448285
   04740 Olfactory transduction
    122448285
   04750 Inflammatory mediator regulation of TRP channels
    122448285
  09159 Environmental adaptation
   04713 Circadian entrainment
    122448285
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122448285
  09162 Cancer: specific types
   05214 Glioma
    122448285
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    122448285
   05163 Human cytomegalovirus infection
    122448285
   05167 Kaposi sarcoma-associated herpesvirus infection
    122448285
  09171 Infectious disease: bacterial
   05133 Pertussis
    122448285
   05152 Tuberculosis
    122448285
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122448285
   05012 Parkinson disease
    122448285
   05022 Pathways of neurodegeneration - multiple diseases
    122448285
  09165 Substance dependence
   05031 Amphetamine addiction
    122448285
   05034 Alcoholism
    122448285
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122448285
   05418 Fluid shear stress and atherosclerosis
    122448285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccad01009]
    122448285
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccad04131]
    122448285
   03036 Chromosome and associated proteins [BR:ccad03036]
    122448285
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccad04147]
    122448285
Protein phosphatases and associated proteins [BR:ccad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     122448285
Membrane trafficking [BR:ccad04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    122448285
Chromosome and associated proteins [BR:ccad03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     122448285
Exosome [BR:ccad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   122448285
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_FSTL1 EF-hand_9 SPARC_Ca_bdg EH SAPC2_N EF_EFCAB10_C EF-hand_STIM1 CFAP251_C MTIP_N Dockerin_1 EF-hand_EFHB_C EF-hand_11 Caleosin DUF5580_M Phage_TAC_12 RPN13_C UPF0154 EF-hand_SWAP70_N RSA-1_C EAP30 ExbD PTS_2-RNA Toprim Toprim_3 DUF3008
Other DBs
NCBI-GeneID: 122448285
NCBI-ProteinID: XP_043335430
LinkDB
Position
10:44635501..44636392
AA seq 149 aa
MAEKLSEEQVAEFKQAFDRFDKDKDGTINVQDLGTVMQELGLKPSEAELKGIIAQLDTDN
NGVISFQEFLGAMASELQTLATEEGLQEIFHALDQDNDGYISVDELRQATSQLEEKMSQD
ELDAMIREADVDQDGRVNYKEFVRILTQN
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcagaaaagctgtccgaagagcaggtggcggagttcaagcaggccttcgacagattc
gacaaggacaaggacggcaccatcaatgtgcaggatctgggcaccgtgatgcaggagctg
ggactgaagccatcagaggctgagctgaaggggatcattgcccagctggacacggacaac
aacggcgtcatcagcttccaggagttcctgggagccatggcctcagagcttcagaccttg
gccacggaggagggcctgcaggaaatcttccatgccttagaccaggacaacgatggctac
atcagcgtggatgagctcaggcaggccacgtcccagctggaggagaagatgtctcaggac
gagctggatgccatgatccgggaggcggacgtggaccaagatggccgggtgaactacaag
gagtttgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system