Cervus canadensis (wapiti): 122448285 Help Entry 122448285         CDS       T07554                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism ccad  Cervus canadensis (wapiti) Pathway ccad04014   Ras signaling pathway ccad04015   Rap1 signaling pathway ccad04020   Calcium signaling pathway ccad04022   cGMP-PKG signaling pathway ccad04024   cAMP signaling pathway ccad04070   Phosphatidylinositol signaling system ccad04114   Oocyte meiosis ccad04218   Cellular senescence ccad04261   Adrenergic signaling in cardiomyocytes ccad04270   Vascular smooth muscle contraction ccad04371   Apelin signaling pathway ccad04625   C-type lectin receptor signaling pathway ccad04713   Circadian entrainment ccad04720   Long-term potentiation ccad04722   Neurotrophin signaling pathway ccad04728   Dopaminergic synapse ccad04740   Olfactory transduction ccad04744   Phototransduction ccad04750   Inflammatory mediator regulation of TRP channels ccad04910   Insulin signaling pathway ccad04912   GnRH signaling pathway ccad04915   Estrogen signaling pathway ccad04916   Melanogenesis ccad04921   Oxytocin signaling pathway ccad04922   Glucagon signaling pathway ccad04924   Renin secretion ccad04925   Aldosterone synthesis and secretion ccad04970   Salivary secretion ccad04971   Gastric acid secretion ccad05010   Alzheimer disease ccad05012   Parkinson disease ccad05022   Pathways of neurodegeneration - multiple diseases ccad05031   Amphetamine addiction ccad05034   Alcoholism ccad05133   Pertussis ccad05152   Tuberculosis ccad05163   Human cytomegalovirus infection ccad05167   Kaposi sarcoma-associated herpesvirus infection ccad05170   Human immunodeficiency virus 1 infection ccad05200   Pathways in cancer ccad05214   Glioma ccad05417   Lipid and atherosclerosis ccad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122448285    04015 Rap1 signaling pathway     122448285    04371 Apelin signaling pathway     122448285    04020 Calcium signaling pathway     122448285    04070 Phosphatidylinositol signaling system     122448285    04024 cAMP signaling pathway     122448285    04022 cGMP-PKG signaling pathway     122448285  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     122448285    04218 Cellular senescence     122448285  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122448285   09152 Endocrine system    04910 Insulin signaling pathway     122448285    04922 Glucagon signaling pathway     122448285    04912 GnRH signaling pathway     122448285    04915 Estrogen signaling pathway     122448285    04921 Oxytocin signaling pathway     122448285    04916 Melanogenesis     122448285    04924 Renin secretion     122448285    04925 Aldosterone synthesis and secretion     122448285   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     122448285    04270 Vascular smooth muscle contraction     122448285   09154 Digestive system    04970 Salivary secretion     122448285    04971 Gastric acid secretion     122448285   09156 Nervous system    04728 Dopaminergic synapse     122448285    04720 Long-term potentiation     122448285    04722 Neurotrophin signaling pathway     122448285   09157 Sensory system    04744 Phototransduction     122448285    04740 Olfactory transduction     122448285    04750 Inflammatory mediator regulation of TRP channels     122448285   09159 Environmental adaptation    04713 Circadian entrainment     122448285  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122448285   09162 Cancer: specific types    05214 Glioma     122448285   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122448285    05163 Human cytomegalovirus infection     122448285    05167 Kaposi sarcoma-associated herpesvirus infection     122448285   09171 Infectious disease: bacterial    05133 Pertussis     122448285    05152 Tuberculosis     122448285   09164 Neurodegenerative disease    05010 Alzheimer disease     122448285    05012 Parkinson disease     122448285    05022 Pathways of neurodegeneration - multiple diseases     122448285   09165 Substance dependence    05031 Amphetamine addiction     122448285    05034 Alcoholism     122448285   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122448285    05418 Fluid shear stress and atherosclerosis     122448285  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccad01009]     122448285   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccad04131]     122448285    03036 Chromosome and associated proteins [BR:ccad03036]     122448285   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccad04147]     122448285 Protein phosphatases and associated proteins [BR:ccad01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      122448285 Membrane trafficking [BR:ccad04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     122448285 Chromosome and associated proteins [BR:ccad03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      122448285 Exosome [BR:ccad04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122448285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 SPARC_Ca_bdg EH EF_EFCAB10_C MTIP_N Dockerin_1 EF-hand_11 Caleosin DUF5580_M Phage_TAC_12 RPN13_C UPF0154 ExbD PTS_2-RNA Toprim DUF3008 Toprim_3 Motif Other DBs NCBI-GeneID:  122448285 NCBI-ProteinID:  XP_043335430 LinkDB All DBs Position 10:44635501..44636392 Genome browser AA seq 149 aa AA seqDB search MAEKLSEEQVAEFKQAFDRFDKDKDGTINVQDLGTVMQELGLKPSEAELKGIIAQLDTDN NGVISFQEFLGAMASELQTLATEEGLQEIFHALDQDNDGYISVDELRQATSQLEEKMSQD ELDAMIREADVDQDGRVNYKEFVRILTQN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaagctgtccgaagagcaggtggcggagttcaagcaggccttcgacagattc gacaaggacaaggacggcaccatcaatgtgcaggatctgggcaccgtgatgcaggagctg ggactgaagccatcagaggctgagctgaaggggatcattgcccagctggacacggacaac aacggcgtcatcagcttccaggagttcctgggagccatggcctcagagcttcagaccttg gccacggaggagggcctgcaggaaatcttccatgccttagaccaggacaacgatggctac atcagcgtggatgagctcaggcaggccacgtcccagctggaggagaagatgtctcaggac gagctggatgccatgatccgggaggcggacgtggaccaagatggccgggtgaactacaag gagtttgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system