KEGG   Cervus canadensis (wapiti): 122448567
Entry
122448567         CDS       T07554                                 
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1-like
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
ccad  Cervus canadensis (wapiti)
Pathway
ccad04010  MAPK signaling pathway
ccad04014  Ras signaling pathway
ccad04015  Rap1 signaling pathway
ccad04024  cAMP signaling pathway
ccad04062  Chemokine signaling pathway
ccad04071  Sphingolipid signaling pathway
ccad04145  Phagosome
ccad04148  Efferocytosis
ccad04151  PI3K-Akt signaling pathway
ccad04310  Wnt signaling pathway
ccad04360  Axon guidance
ccad04370  VEGF signaling pathway
ccad04380  Osteoclast differentiation
ccad04510  Focal adhesion
ccad04517  IgSF CAM signaling
ccad04518  Integrin signaling
ccad04520  Adherens junction
ccad04530  Tight junction
ccad04613  Neutrophil extracellular trap formation
ccad04620  Toll-like receptor signaling pathway
ccad04650  Natural killer cell mediated cytotoxicity
ccad04662  B cell receptor signaling pathway
ccad04664  Fc epsilon RI signaling pathway
ccad04666  Fc gamma R-mediated phagocytosis
ccad04670  Leukocyte transendothelial migration
ccad04722  Neurotrophin signaling pathway
ccad04810  Regulation of actin cytoskeleton
ccad04932  Non-alcoholic fatty liver disease
ccad04933  AGE-RAGE signaling pathway in diabetic complications
ccad04972  Pancreatic secretion
ccad05014  Amyotrophic lateral sclerosis
ccad05020  Prion disease
ccad05022  Pathways of neurodegeneration - multiple diseases
ccad05100  Bacterial invasion of epithelial cells
ccad05132  Salmonella infection
ccad05135  Yersinia infection
ccad05163  Human cytomegalovirus infection
ccad05167  Kaposi sarcoma-associated herpesvirus infection
ccad05169  Epstein-Barr virus infection
ccad05170  Human immunodeficiency virus 1 infection
ccad05200  Pathways in cancer
ccad05203  Viral carcinogenesis
ccad05205  Proteoglycans in cancer
ccad05208  Chemical carcinogenesis - reactive oxygen species
ccad05210  Colorectal cancer
ccad05211  Renal cell carcinoma
ccad05212  Pancreatic cancer
ccad05231  Choline metabolism in cancer
ccad05415  Diabetic cardiomyopathy
ccad05416  Viral myocarditis
ccad05417  Lipid and atherosclerosis
ccad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    122448567
   04014 Ras signaling pathway
    122448567
   04015 Rap1 signaling pathway
    122448567
   04310 Wnt signaling pathway
    122448567
   04370 VEGF signaling pathway
    122448567
   04071 Sphingolipid signaling pathway
    122448567
   04024 cAMP signaling pathway
    122448567
   04151 PI3K-Akt signaling pathway
    122448567
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    122448567
   04518 Integrin signaling
    122448567
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    122448567
   04148 Efferocytosis
    122448567
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    122448567
   04520 Adherens junction
    122448567
   04530 Tight junction
    122448567
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122448567
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    122448567
   04620 Toll-like receptor signaling pathway
    122448567
   04650 Natural killer cell mediated cytotoxicity
    122448567
   04662 B cell receptor signaling pathway
    122448567
   04664 Fc epsilon RI signaling pathway
    122448567
   04666 Fc gamma R-mediated phagocytosis
    122448567
   04670 Leukocyte transendothelial migration
    122448567
   04062 Chemokine signaling pathway
    122448567
  09154 Digestive system
   04972 Pancreatic secretion
    122448567
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    122448567
  09158 Development and regeneration
   04360 Axon guidance
    122448567
   04380 Osteoclast differentiation
    122448567
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122448567
   05205 Proteoglycans in cancer
    122448567
   05208 Chemical carcinogenesis - reactive oxygen species
    122448567
   05203 Viral carcinogenesis
    122448567
   05231 Choline metabolism in cancer
    122448567
  09162 Cancer: specific types
   05210 Colorectal cancer
    122448567
   05212 Pancreatic cancer
    122448567
   05211 Renal cell carcinoma
    122448567
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    122448567
   05163 Human cytomegalovirus infection
    122448567
   05167 Kaposi sarcoma-associated herpesvirus infection
    122448567
   05169 Epstein-Barr virus infection
    122448567
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    122448567
   05135 Yersinia infection
    122448567
   05100 Bacterial invasion of epithelial cells
    122448567
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    122448567
   05020 Prion disease
    122448567
   05022 Pathways of neurodegeneration - multiple diseases
    122448567
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122448567
   05418 Fluid shear stress and atherosclerosis
    122448567
   05415 Diabetic cardiomyopathy
    122448567
   05416 Viral myocarditis
    122448567
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    122448567
   04933 AGE-RAGE signaling pathway in diabetic complications
    122448567
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccad04131]
    122448567
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccad04147]
    122448567
   04031 GTP-binding proteins [BR:ccad04031]
    122448567
Membrane trafficking [BR:ccad04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    122448567
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    122448567
  Macropinocytosis
   Ras GTPases
    122448567
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    122448567
Exosome [BR:ccad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   122448567
  Exosomal proteins of other body fluids (saliva and urine)
   122448567
  Exosomal proteins of colorectal cancer cells
   122448567
  Exosomal proteins of bladder cancer cells
   122448567
GTP-binding proteins [BR:ccad04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    122448567
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 122448567
NCBI-ProteinID: XP_043335909
LinkDB
Position
10:complement(31361871..31363996)
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVEGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAILAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtgggtaagacttgcctcctg
atcagttacactaccaatgcatttcctggagaatacatccccactgtctttgacaactac
tctgccaatgtcatggtggagggaaaacccgtgaatctgggcttgtgggacacagccgga
caagaagattatgaccgattacgccccctgtcctacccgcagacagatgtattcttaatt
tgcttttctcttgtgagtcctgcatcatttgaaaatgttcgtgcaaagtggtaccctgaa
gtgcgacaccactgtcccaacacacccatcatcctggtggggacgaaacttgacctgagg
gacgataaagacacgatcgagaagctgaaggagaagaagctgacgcccatcacctacccg
cagggcttggccatggccaaggagatcggtgccgtcaaatacctggagtgctcggcgctc
acgcagcgaggcctcaagacagtgtttgatgaagcgatcctggcggttctctgcccgccc
cccgtcaagaagaggaagagaaagtgcctgctcttgtga

DBGET integrated database retrieval system