Cervus canadensis (wapiti): 122448845 Help Entry 122448845         CDS       T07554                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ccad  Cervus canadensis (wapiti) Pathway ccad01521   EGFR tyrosine kinase inhibitor resistance ccad01524   Platinum drug resistance ccad04014   Ras signaling pathway ccad04064   NF-kappa B signaling pathway ccad04115   p53 signaling pathway ccad04137   Mitophagy - animal ccad04140   Autophagy - animal ccad04151   PI3K-Akt signaling pathway ccad04210   Apoptosis ccad04215   Apoptosis - multiple species ccad04621   NOD-like receptor signaling pathway ccad04630   JAK-STAT signaling pathway ccad05012   Parkinson disease ccad05014   Amyotrophic lateral sclerosis ccad05022   Pathways of neurodegeneration - multiple diseases ccad05145   Toxoplasmosis ccad05162   Measles ccad05166   Human T-cell leukemia virus 1 infection ccad05168   Herpes simplex virus 1 infection ccad05170   Human immunodeficiency virus 1 infection ccad05200   Pathways in cancer ccad05202   Transcriptional misregulation in cancer ccad05212   Pancreatic cancer ccad05220   Chronic myeloid leukemia ccad05222   Small cell lung cancer ccad05225   Hepatocellular carcinoma ccad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     122448845 (BCL2L1)    04630 JAK-STAT signaling pathway     122448845 (BCL2L1)    04064 NF-kappa B signaling pathway     122448845 (BCL2L1)    04151 PI3K-Akt signaling pathway     122448845 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122448845 (BCL2L1)    04137 Mitophagy - animal     122448845 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     122448845 (BCL2L1)    04215 Apoptosis - multiple species     122448845 (BCL2L1)    04115 p53 signaling pathway     122448845 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     122448845 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122448845 (BCL2L1)    05202 Transcriptional misregulation in cancer     122448845 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     122448845 (BCL2L1)    05225 Hepatocellular carcinoma     122448845 (BCL2L1)    05220 Chronic myeloid leukemia     122448845 (BCL2L1)    05222 Small cell lung cancer     122448845 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122448845 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     122448845 (BCL2L1)    05162 Measles     122448845 (BCL2L1)    05168 Herpes simplex virus 1 infection     122448845 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     122448845 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     122448845 (BCL2L1)    05014 Amyotrophic lateral sclerosis     122448845 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     122448845 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122448845 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     122448845 (BCL2L1)    01524 Platinum drug resistance     122448845 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccad01009]     122448845 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccad03036]     122448845 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ccad02000]     122448845 (BCL2L1) Protein phosphatases and associated proteins [BR:ccad01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      122448845 (BCL2L1) Chromosome and associated proteins [BR:ccad03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     122448845 (BCL2L1) Transporters [BR:ccad02000]  Other transporters   Pores ion channels [TC:1]    122448845 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 PROCT Motif Other DBs NCBI-GeneID:  122448845 NCBI-ProteinID:  XP_043336416 LinkDB All DBs Position 10:complement(60074260..60124820) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFNDVEENRTEAPEGTESDMETRSAINGNPSWHLA DSPAVNGATGHSRSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcttacaagctttcccagaaa ggatacagctggagtcagtttaatgatgtggaagagaacagaactgaggccccagaaggg acagaatcagatatggaaacccgcagtgccatcaatggcaacccatcctggcacctggca gatagccctgcggtgaatggagccactggccacagcagaagcttggatgcccgggaagtg atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg taccgacgggcattcagcgacctgacgtcccagctccacatcaccccagggacagcttat cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system