Cervus canadensis (wapiti): 122449577 Help Entry 122449577         CDS       T07554                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism ccad  Cervus canadensis (wapiti) Pathway ccad04060   Cytokine-cytokine receptor interaction ccad04061   Viral protein interaction with cytokine and cytokine receptor ccad04062   Chemokine signaling pathway ccad04620   Toll-like receptor signaling pathway ccad05142   Chagas disease ccad05163   Human cytomegalovirus infection ccad05323   Rheumatoid arthritis ccad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122449577    04061 Viral protein interaction with cytokine and cytokine receptor     122449577  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122449577    04062 Chemokine signaling pathway     122449577  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     122449577   09174 Infectious disease: parasitic    05142 Chagas disease     122449577   09163 Immune disease    05323 Rheumatoid arthritis     122449577   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122449577  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122449577    00536 Glycosaminoglycan binding proteins [BR:ccad00536]     122449577 Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Chemokines    122449577 Glycosaminoglycan binding proteins [BR:ccad00536]  Heparan sulfate / Heparin   Chemokines    122449577 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  122449577 NCBI-ProteinID:  XP_043337259 LinkDB All DBs Position 1:45841683..45843447 Genome browser AA seq 93 aa AA seqDB search MELRGAALAVLLLTAALSAHTCSASLGANTPTACCFSFVSRQIPRKFVDDYYETSSQCSQ PGVIFKTKRGRQVCADPSEDWVQEYITDLELNP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggagctccgcggggccgccctggctgtcctgctgctcaccgcggccctctctgcccac acctgctcggccagccttggtgccaacaccccgaccgcctgctgcttctccttcgtctcc cggcagatcccacgcaaattcgtggacgactattatgagaccagcagccagtgctcccag cccggcgtcatcttcaagaccaaaagaggccggcaggtctgtgccgaccccagtgaggac tgggtccaggaatacattaccgacctggagctgaatccctga

DBGET integrated database retrieval system