Cervus canadensis (wapiti): 122451656 Help Entry 122451656         CDS       T07554                                  Name (RefSeq) histone H3.3C-like   KO K11253   histone H3 Organism ccad  Cervus canadensis (wapiti) Pathway ccad04613   Neutrophil extracellular trap formation ccad05034   Alcoholism ccad05202   Transcriptional misregulation in cancer ccad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122451656  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     122451656   09163 Immune disease    05322 Systemic lupus erythematosus     122451656   09165 Substance dependence    05034 Alcoholism     122451656  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccad03036]     122451656   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccad04147]     122451656 Chromosome and associated proteins [BR:ccad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     122451656 Exosome [BR:ccad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122451656 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF HepT-like Motif Other DBs NCBI-GeneID:  122451656 NCBI-ProteinID:  XP_043340483 LinkDB All DBs Position 13:complement(48355368..48418495) Genome browser AA seq 136 aa AA seqDB search MARTKRTACKSTGGKAPRKQLVIEAAGKSDPSTSGMTRPHRYRPGTVALREIRPYQKSTH FLIRKLPFQRLVREIAQDFKTDLKFQSAAIRTLQEASEAYLVVFLESKQHSNLARMYSQS KSFPWLEGKRRQLQPM NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccggaccaagaggacagcttgtaaatccacgggtgggaaagcgccccgcaaacag ctggtcatcgaagcggccgggaaaagcgacccctctaccagcgggatgacaagacctcat cgctacaggcccgggaccgttgccctccgagaaatccgtccttaccagaaatccacccat tttctgattcggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa accgacttgaagttccagagtgccgccatccgtacgctgcaggaggctagcgaagcgtac ctggttgtattccttgagtccaagcagcatagtaatctggcaagaatgtactcccagagt aagagctttccatggcttgaaggaaaaaggagacagctacaacccatgtaa

DBGET integrated database retrieval system