Cervus canadensis (wapiti): 122453310 Help Entry 122453310         CDS       T07554                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism ccad  Cervus canadensis (wapiti) Pathway ccad04060   Cytokine-cytokine receptor interaction ccad04151   PI3K-Akt signaling pathway ccad04217   Necroptosis ccad04620   Toll-like receptor signaling pathway ccad04621   NOD-like receptor signaling pathway ccad04622   RIG-I-like receptor signaling pathway ccad04623   Cytosolic DNA-sensing pathway ccad04630   JAK-STAT signaling pathway ccad04650   Natural killer cell mediated cytotoxicity ccad04936   Alcoholic liver disease ccad05152   Tuberculosis ccad05160   Hepatitis C ccad05161   Hepatitis B ccad05162   Measles ccad05163   Human cytomegalovirus infection ccad05164   Influenza A ccad05165   Human papillomavirus infection ccad05167   Kaposi sarcoma-associated herpesvirus infection ccad05168   Herpes simplex virus 1 infection ccad05169   Epstein-Barr virus infection ccad05170   Human immunodeficiency virus 1 infection ccad05171   Coronavirus disease - COVID-19 ccad05200   Pathways in cancer ccad05320   Autoimmune thyroid disease ccad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122453310    04151 PI3K-Akt signaling pathway     122453310   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122453310  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122453310  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122453310    04621 NOD-like receptor signaling pathway     122453310    04622 RIG-I-like receptor signaling pathway     122453310    04623 Cytosolic DNA-sensing pathway     122453310    04650 Natural killer cell mediated cytotoxicity     122453310  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122453310   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122453310    05161 Hepatitis B     122453310    05160 Hepatitis C     122453310    05171 Coronavirus disease - COVID-19     122453310    05164 Influenza A     122453310    05162 Measles     122453310    05168 Herpes simplex virus 1 infection     122453310    05163 Human cytomegalovirus infection     122453310    05167 Kaposi sarcoma-associated herpesvirus infection     122453310    05169 Epstein-Barr virus infection     122453310    05165 Human papillomavirus infection     122453310   09171 Infectious disease: bacterial    05152 Tuberculosis     122453310   09163 Immune disease    05320 Autoimmune thyroid disease     122453310   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122453310   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122453310  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122453310 Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Interferons    122453310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  122453310 NCBI-ProteinID:  XP_043343227 LinkDB All DBs Position 14:complement(48265346..48265915) Genome browser AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSLGCHLPHTHSLANRRVLTLLQQLRRVSPSSCLQDRNDFA FPQEVLGGSQLQRAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRTALDQQLTDLQ ACLRQEQGLQGAPLLKGDSSLALRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSPN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgc tctctgggctgccacctgcctcacacccacagcctggccaacaggagggtcctgacactc ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggtgctgggtggcagccagctgcagagggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcactgagggctcggccgctgcgtgg gaccagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggagcaggggctgcaaggggctcccctgctcaagggggactccagc ctggctctgaggaaatacttccacagagtcactctctacctgcaagagaagggacacagc ccttgtgcctgggaggtcgtcagagcagaagtcatgagagccttctcttcctcaccaaac ttgcaggagaggttccggaggaaggactga

DBGET integrated database retrieval system