Cervus canadensis (wapiti): 122453350 Help Entry 122453350         CDS       T07554                                  Name (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism ccad  Cervus canadensis (wapiti) Pathway ccad04060   Cytokine-cytokine receptor interaction ccad04151   PI3K-Akt signaling pathway ccad04217   Necroptosis ccad04620   Toll-like receptor signaling pathway ccad04621   NOD-like receptor signaling pathway ccad04622   RIG-I-like receptor signaling pathway ccad04623   Cytosolic DNA-sensing pathway ccad04630   JAK-STAT signaling pathway ccad04650   Natural killer cell mediated cytotoxicity ccad04936   Alcoholic liver disease ccad05152   Tuberculosis ccad05160   Hepatitis C ccad05161   Hepatitis B ccad05162   Measles ccad05163   Human cytomegalovirus infection ccad05164   Influenza A ccad05165   Human papillomavirus infection ccad05167   Kaposi sarcoma-associated herpesvirus infection ccad05168   Herpes simplex virus 1 infection ccad05169   Epstein-Barr virus infection ccad05170   Human immunodeficiency virus 1 infection ccad05171   Coronavirus disease - COVID-19 ccad05200   Pathways in cancer ccad05320   Autoimmune thyroid disease ccad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122453350    04151 PI3K-Akt signaling pathway     122453350   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122453350  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122453350  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122453350    04621 NOD-like receptor signaling pathway     122453350    04622 RIG-I-like receptor signaling pathway     122453350    04623 Cytosolic DNA-sensing pathway     122453350    04650 Natural killer cell mediated cytotoxicity     122453350  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122453350   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122453350    05161 Hepatitis B     122453350    05160 Hepatitis C     122453350    05171 Coronavirus disease - COVID-19     122453350    05164 Influenza A     122453350    05162 Measles     122453350    05168 Herpes simplex virus 1 infection     122453350    05163 Human cytomegalovirus infection     122453350    05167 Kaposi sarcoma-associated herpesvirus infection     122453350    05169 Epstein-Barr virus infection     122453350    05165 Human papillomavirus infection     122453350   09171 Infectious disease: bacterial    05152 Tuberculosis     122453350   09163 Immune disease    05320 Autoimmune thyroid disease     122453350   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122453350   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122453350  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccad04052]     122453350 Cytokines and neuropeptides [BR:ccad04052]  Cytokines   Interferons    122453350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon MINION Motif Other DBs NCBI-GeneID:  122453350 NCBI-ProteinID:  XP_043343275 LinkDB All DBs Position 14:48575652..48577104 Genome browser AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNSICSLGCHLPPTHSLANRRVLTLLRQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAAAWDQSLLDKLRTALDQQLTDLQ ACLRQEQGLQGAPLLKGDSSLALRKYFHRVTLYLQEKGHSPCAWEVVRAEVMRAFSSSPN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttactcctggccctgctgctgctcagctgcaactccatctgc tctctgggctgccacctgcctcccacccacagcctggccaacaggagggtcctgacgctc ctgcgacaactgaggagggtctccccttcctcctgcctgcaggacaggaatgacttcgca ttcccccaggaggcgctgggtggcagccagctgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcactgagggctcggccgctgcgtgg gaccagagcctcctggacaagctccgcactgcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggagcaggggctgcaaggggctcccctgctcaagggggactccagc ctggctctgaggaaatacttccacagagtcactctctatctgcaagagaagggacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaccaaac ttgcaggagaggttccggaggaaggactga

DBGET integrated database retrieval system