Cervus canadensis (wapiti): 122455294 Help Entry 122455294         CDS       T07554                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism ccad  Cervus canadensis (wapiti) Pathway ccad04024   cAMP signaling pathway ccad04062   Chemokine signaling pathway ccad04064   NF-kappa B signaling pathway ccad04210   Apoptosis ccad04380   Osteoclast differentiation ccad04519   Cadherin signaling ccad04620   Toll-like receptor signaling pathway ccad04621   NOD-like receptor signaling pathway ccad04622   RIG-I-like receptor signaling pathway ccad04623   Cytosolic DNA-sensing pathway ccad04625   C-type lectin receptor signaling pathway ccad04657   IL-17 signaling pathway ccad04658   Th1 and Th2 cell differentiation ccad04659   Th17 cell differentiation ccad04660   T cell receptor signaling pathway ccad04662   B cell receptor signaling pathway ccad04668   TNF signaling pathway ccad04722   Neurotrophin signaling pathway ccad04920   Adipocytokine signaling pathway ccad04926   Relaxin signaling pathway ccad04931   Insulin resistance ccad04936   Alcoholic liver disease ccad05132   Salmonella infection ccad05134   Legionellosis ccad05135   Yersinia infection ccad05140   Leishmaniasis ccad05142   Chagas disease ccad05145   Toxoplasmosis ccad05160   Hepatitis C ccad05161   Hepatitis B ccad05162   Measles ccad05163   Human cytomegalovirus infection ccad05164   Influenza A ccad05166   Human T-cell leukemia virus 1 infection ccad05167   Kaposi sarcoma-associated herpesvirus infection ccad05168   Herpes simplex virus 1 infection ccad05169   Epstein-Barr virus infection ccad05170   Human immunodeficiency virus 1 infection ccad05171   Coronavirus disease ccad05200   Pathways in cancer ccad05203   Viral carcinogenesis ccad05208   Chemical carcinogenesis - reactive oxygen species ccad05215   Prostate cancer ccad05220   Chronic myeloid leukemia ccad05222   Small cell lung cancer ccad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ccad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccad00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     122455294 (NFKBIA)    04668 TNF signaling pathway     122455294 (NFKBIA)    04024 cAMP signaling pathway     122455294 (NFKBIA)   09133 Signaling molecules and interaction    04519 Cadherin signaling     122455294 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     122455294 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122455294 (NFKBIA)    04621 NOD-like receptor signaling pathway     122455294 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     122455294 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     122455294 (NFKBIA)    04625 C-type lectin receptor signaling pathway     122455294 (NFKBIA)    04660 T cell receptor signaling pathway     122455294 (NFKBIA)    04658 Th1 and Th2 cell differentiation     122455294 (NFKBIA)    04659 Th17 cell differentiation     122455294 (NFKBIA)    04657 IL-17 signaling pathway     122455294 (NFKBIA)    04662 B cell receptor signaling pathway     122455294 (NFKBIA)    04062 Chemokine signaling pathway     122455294 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     122455294 (NFKBIA)    04926 Relaxin signaling pathway     122455294 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     122455294 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     122455294 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122455294 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     122455294 (NFKBIA)    05203 Viral carcinogenesis     122455294 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122455294 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     122455294 (NFKBIA)    05215 Prostate cancer     122455294 (NFKBIA)    05222 Small cell lung cancer     122455294 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122455294 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     122455294 (NFKBIA)    05161 Hepatitis B     122455294 (NFKBIA)    05160 Hepatitis C     122455294 (NFKBIA)    05171 Coronavirus disease     122455294 (NFKBIA)    05164 Influenza A     122455294 (NFKBIA)    05162 Measles     122455294 (NFKBIA)    05168 Herpes simplex virus 1 infection     122455294 (NFKBIA)    05163 Human cytomegalovirus infection     122455294 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     122455294 (NFKBIA)    05169 Epstein-Barr virus infection     122455294 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     122455294 (NFKBIA)    05135 Yersinia infection     122455294 (NFKBIA)    05134 Legionellosis     122455294 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     122455294 (NFKBIA)    05140 Leishmaniasis     122455294 (NFKBIA)    05142 Chagas disease     122455294 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122455294 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122455294 (NFKBIA)    04931 Insulin resistance     122455294 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ccad03000]     122455294 (NFKBIA)    04131 Membrane trafficking [BR:ccad04131]     122455294 (NFKBIA) Transcription factors [BR:ccad03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     122455294 (NFKBIA) Membrane trafficking [BR:ccad04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     122455294 (NFKBIA) SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  122455294 NCBI-ProteinID:  XP_043346248 LinkDB All DBs Position 17:23276866..23280418 Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggaactgcgagagatccgcctggagccgcaggaggcgccg cgcggcgccgagccctggaaacagcagctcacggaggacggagactcgttcctgcacttg gccatcatccacgaagagaaggcgctgaccatggaagtggtccgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc actaaccagccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagcgtg ggagtcctgactcagccccgggggacccagcaccttcactccatcctgcaggccaccaac tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc ctccatctggcagtggacctgcagaaccccgacctggtgtcactcctgttgaagtgtggg gccgatgtcaacagggtcacctaccagggctactcaccgtaccagctcacgtggggccgc cccagcacgcggatacagcagcagctgggccagctgaccctagagaacctgcagacgctg ccagagagtgaggatgaggagagctatgacaccgagtcagagttcaccgaggacgagctt ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system